U2AF1L4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: U2AF1L4 Antibody [NBP2-55898] - Staining of human cell line A549 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

U2AF1L4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP
Specificity
Specificity of human U2AF1L4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
U2AF1L4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
U2AF1L4 Recombinant Protein Antigen (NBP2-55898PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for U2AF1L4 Antibody

  • FLJ35525
  • MGC33901
  • splicing factor U2AF 26 kDa subunit
  • U2 auxiliary factor 26
  • U2 small nuclear RNA auxiliary factor 1-like 3
  • U2 small nuclear RNA auxiliary factor 1-like 4
  • U2 small nuclear RNA auxiliary factor 1-like protein 3
  • U2 small nuclear RNA auxiliary factor 1-like protein 4
  • U2(RNU2) small nuclear RNA auxiliary factor 1-like 3
  • U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3
  • U2AF1L3
  • U2AF1L3V1
  • U2AF1-like protein 3
  • U2AF1RS3
  • U2AF1-RS3
  • U2af26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32515
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57307
Species: Hu
Applications: WB
AF5359
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-33397
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P, KD
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP3-05514
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC, IHC-P
NBP1-31209
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86125
Species: Hu
Applications: IHC, IHC-P
NB100-77417
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NBP2-55898
Species: Hu
Applications: ICC/IF

Publications for U2AF1L4 Antibody (NBP2-55898) (0)

There are no publications for U2AF1L4 Antibody (NBP2-55898).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for U2AF1L4 Antibody (NBP2-55898) (0)

There are no reviews for U2AF1L4 Antibody (NBP2-55898). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for U2AF1L4 Antibody (NBP2-55898) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional U2AF1L4 Products

Bioinformatics Tool for U2AF1L4 Antibody (NBP2-55898)

Discover related pathways, diseases and genes to U2AF1L4 Antibody (NBP2-55898). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for U2AF1L4 Antibody (NBP2-55898)

View related products by pathway.

Blogs on U2AF1L4

There are no specific blogs for U2AF1L4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our U2AF1L4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol U2AF1L4