Tyk2 Antibody (6G12)

Images

 
Western Blot: Tyk2 Antibody (6G12) [H00007297-M01] - TYK2 monoclonal antibody (M01), clone 6G12 Analysis of TYK2 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: Tyk2 Antibody (6G12) [H00007297-M01] - Analysis of monoclonal antibody to TYK2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Tyk2 Antibody (6G12) [H00007297-M01] - Analysis of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: Tyk2 Antibody (6G12) [H00007297-M01] - Analysis of TYK2 expression in transfected 293T cell line by TYK2 monoclonal antibody (M01), clone 6G12.Lane 1: TYK2 transfected lysate(133.7 KDa).Lane 2: ...read more
Immunoprecipitation: Tyk2 Antibody (6G12) [H00007297-M01] - Analysis of TYK2 transfected lysate using anti-TYK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TYK2 MaxPab rabbit polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, IP
Clone
6G12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Tyk2 Antibody (6G12) Summary

Immunogen
TYK2 (AAH14243 276 a.a. - 375 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA
Specificity
TYK2 - tyrosine kinase 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TYK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Tyk2 Antibody (6G12)

  • EC 2.7.10
  • EC 2.7.10.2
  • JTK1
  • non-receptor tyrosine-protein kinase TYK2
  • Tyk2
  • tyrosine kinase 2

Background

This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
AF2988
Species: Mu, Rt
Applications: WB
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-37737
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
AF2890
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF5629
Species: Hu, Mu
Applications: WB
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00007297-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for Tyk2 Antibody (H00007297-M01) (0)

There are no publications for Tyk2 Antibody (H00007297-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tyk2 Antibody (H00007297-M01) (0)

There are no reviews for Tyk2 Antibody (H00007297-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tyk2 Antibody (H00007297-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tyk2 Products

Bioinformatics Tool for Tyk2 Antibody (H00007297-M01)

Discover related pathways, diseases and genes to Tyk2 Antibody (H00007297-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tyk2 Antibody (H00007297-M01)

Discover more about diseases related to Tyk2 Antibody (H00007297-M01).
 

Pathways for Tyk2 Antibody (H00007297-M01)

View related products by pathway.

PTMs for Tyk2 Antibody (H00007297-M01)

Learn more about PTMs related to Tyk2 Antibody (H00007297-M01).
 

Research Areas for Tyk2 Antibody (H00007297-M01)

Find related products by research area.

Blogs on Tyk2

There are no specific blogs for Tyk2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tyk2 Antibody (6G12) and receive a gift card or discount.

Bioinformatics

Gene Symbol TYK2
Entrez
OMIM
Uniprot