TUBGCP5 Recombinant Protein Antigen

Images

 
There are currently no images for TUBGCP5 Recombinant Protein Antigen (NBP2-55676PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TUBGCP5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TUBGCP5.

Source: E. coli

Amino Acid Sequence: SLYTLFLESVQSRLRHGEDSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFARMYLEQSDFHEKFAGGDVCVDRSSESVTCQTFELTLRSC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TUBGCP5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55676.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TUBGCP5 Recombinant Protein Antigen

  • gamma-tubulin complex component 5
  • gamma-tubulin complex component GCP5
  • GCP5KIAA1899GCP-5
  • tubulin, gamma complex associated protein 5

Background

The gamma-Tubulin complex is composed of gamma Tubulin and the gamma-Tubulin complexassociated proteins GCP2, GCP3, GCP4, GCP5 and GCP6, all of which are essential components of microtubule organizing centers. gamma-Tubulin complex components are localized to both the centrosome, where they are involved in microtubule nucleation, and to the cytoplasm, where they exist as soluble complexes that can be recruited to the centrosome as needed. Although the GCP proteins are related, they have distinct roles which contribute to the proper function of the gamma-Tubulin complex. GCP5 (gamma-Tubulin complex component 5), also known as TUBGCP5, is a 1,024 amino acid member of the gamma-Tubulin complex and is highly expressed in heart and skeletal muscle. Defects in the gene encoding GCP5 are implicated in Prader-Willi syndrome (PWS), a rare genetic disorder associated with obesity, compulsive behavior and lower intellectual ability.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49510
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-93476
Species: Hu
Applications: IHC,  IHC-P
NBP2-16060
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-90313
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81841
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-45057
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB333
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
AF674
Species: Hu
Applications: Neut, Simple Western, WB
NBP3-45685
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB100-481
Species: Hu
Applications: ChIP, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-94428
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
H00007337-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
NBP1-89102
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-30779
Species: Hu
Applications: IHC,  IHC-P
AF638
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-22377
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-55676PEP
Species: Hu
Applications: AC

Publications for TUBGCP5 Recombinant Protein Antigen (NBP2-55676PEP) (0)

There are no publications for TUBGCP5 Recombinant Protein Antigen (NBP2-55676PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TUBGCP5 Recombinant Protein Antigen (NBP2-55676PEP) (0)

There are no reviews for TUBGCP5 Recombinant Protein Antigen (NBP2-55676PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TUBGCP5 Recombinant Protein Antigen (NBP2-55676PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TUBGCP5 Products

Research Areas for TUBGCP5 Recombinant Protein Antigen (NBP2-55676PEP)

Find related products by research area.

Blogs on TUBGCP5

There are no specific blogs for TUBGCP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TUBGCP5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBGCP5