Recombinant Human TUBGCP5 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human TUBGCP5 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-99 of Human TUBGCP5
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHKIEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSI

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: TUBGCP5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 36.63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TUBGCP5 GST (N-Term) Protein

• gamma-tubulin complex component 5
• gamma-tubulin complex component GCP5
• GCP5KIAA1899GCP-5
• tubulin, gamma complex associated protein 5

Background

The gamma-Tubulin complex is composed of gamma Tubulin and the gamma-Tubulin complexassociated proteins GCP2, GCP3, GCP4, GCP5 and GCP6, all of which are essential components of microtubule organizing centers. gamma-Tubulin complex components are localized to both the centrosome, where they are involved in microtubule nucleation, and to the cytoplasm, where they exist as soluble complexes that can be recruited to the centrosome as needed. Although the GCP proteins are related, they have distinct roles which contribute to the proper function of the gamma-Tubulin complex. GCP5 (gamma-Tubulin complex component 5), also known as TUBGCP5, is a 1,024 amino acid member of the gamma-Tubulin complex and is highly expressed in heart and skeletal muscle. Defects in the gene encoding GCP5 are implicated in Prader-Willi syndrome (PWS), a rare genetic disorder associated with obesity, compulsive behavior and lower intellectual ability.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TUBGCP5