TTYH1 Antibody - BSA Free

Western Blot: TTYH1 Antibody [NBP1-59909] - Hela cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TTYH1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TTYH1(tweety homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of TTYH1. Peptide sequence GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TTYH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunohistochemistry and Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 31138989).

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31138989).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TTYH1 Antibody - BSA Free

• hTTY1
• protein tweety homolog 1
• tweety (Drosophila) homolog 1
• tweety homolog 1 (Drosophila)

Background

TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TTYH1 Antibody (NBP1-59909)(2)

Publications using NBP1-59909

• Wu L, Pandey V, Casha V et al. The cell-surface shared proteome of astrocytes and neurons and the molecular foundations of their multicellular interactions. Neuron 2025-06-05 [PMID: 40499536]
• Simile MM, Peitta G, Tomasi ML et al. Tweety-homolog (Ttyh) Family Encodes the Pore-forming Subunits of the Swelling-dependent Volume-regulated Anion Channel (VRACswell) in the Brain Exp Neurobiol 2019-04-01 [PMID: 31138989] (ICC/IF, WB, IF/IHC, Human, Mouse)

Bioinformatics

• Gene Symbol: TTYH1
• Uniprot:
  • Q9H313(Human)