TTYH1 Antibody

Images

 
Western Blot: TTYH1 Antibody [NBP1-59909] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTYH1 Antibody Summary

Immunogen
Synthetic peptides corresponding to TTYH1(tweety homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of TTYH1. Peptide sequence GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTYH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TTYH1 and was validated on Western blot. Use in Immunohistochemistry and Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 31138989).
Publications
Read Publication using
NBP1-59909 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31138989).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TTYH1 Antibody

  • hTTY1
  • protein tweety homolog 1
  • tweety (Drosophila) homolog 1
  • tweety homolog 1 (Drosophila)

Background

TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41177
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
MAB6747
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NBP1-90979
Species: Hu
Applications: IHC, IHC-P
NBP1-91350
Species: Hu
Applications: WB
NB100-56534
Species: Hu, Mu
Applications: ChIP, Flow, ICC, IHC, IHC-P, WB
NBP1-33177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24513
Species: Bv, Ca, Eq, Hu, Mu, Ma-Op, Pm, RM
Applications: IHC, IHC-P, WB
NBP2-94909
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB300-213
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
H00011280-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-80467
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-03833
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00023327-P01
Species: Hu
Applications: ELISA, Func, AP, PA, WB
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
NBP2-93677
Species: Hu, Mu, Rt
Applications: WB
NBP2-94213
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-00580
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-76924
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB

Publications for TTYH1 Antibody (NBP1-59909)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for TTYH1 Antibody (NBP1-59909) (0)

There are no reviews for TTYH1 Antibody (NBP1-59909). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TTYH1 Antibody (NBP1-59909) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TTYH1 Products

Bioinformatics Tool for TTYH1 Antibody (NBP1-59909)

Discover related pathways, diseases and genes to TTYH1 Antibody (NBP1-59909). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTYH1 Antibody (NBP1-59909)

Discover more about diseases related to TTYH1 Antibody (NBP1-59909).
 

Pathways for TTYH1 Antibody (NBP1-59909)

View related products by pathway.

PTMs for TTYH1 Antibody (NBP1-59909)

Learn more about PTMs related to TTYH1 Antibody (NBP1-59909).

Blogs on TTYH1

There are no specific blogs for TTYH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTYH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TTYH1
Uniprot