TTYH3 Antibody

Images

 
Western Blot: TTYH3 Antibody [NBP1-91350] - Human kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTYH3 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human TTYH3. Peptide sequence IIATLVCSAGIAVGFYGNGETSDGIHRATYSLRHANRTVAGVQDRVWDTA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TTYH3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TTYH3 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-91350 in the following application:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TTYH3 Antibody

  • hTTY3
  • KIAA1691
  • protein tweety homolog 3
  • tweety homolog 3 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41177
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-59909
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
NBP2-38869
Species: Hu
Applications: IHC, IHC-P
NBP2-30425
Species: Ha, Hu
Applications: ICC/IF, IHC, IHC-P
MAB6609
Species: Hu, Mu
Applications: IHC, WB
NBP2-33482
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
NBP2-92365
Species: Hu, Rt
Applications: WB
H00023327-P01
Species: Hu
Applications: ELISA, Func, AP, PA, WB

Publications for TTYH3 Antibody (NBP1-91350) (0)

There are no publications for TTYH3 Antibody (NBP1-91350).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TTYH3 Antibody (NBP1-91350) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-91350:
Filter by Applications
Flow
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Flow Cytometry TTYH3 NBP1-91350
Enlarge
4
reviewed by:
Verified Customer
Flow Human 11/30/2015
View

Summary

ApplicationFlow Cytometry
Sample TestedAML cell lines
SpeciesHuman

Blocking

Blocking Detailsn/a

Secondary Antibody

Secondary DescriptionAF647

Details

Detection Notesn/a

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTYH3 Antibody (NBP1-91350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TTYH3 Products

Array NBP1-91350

Bioinformatics Tool for TTYH3 Antibody (NBP1-91350)

Discover related pathways, diseases and genes to TTYH3 Antibody (NBP1-91350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTYH3 Antibody (NBP1-91350)

Discover more about diseases related to TTYH3 Antibody (NBP1-91350).

PTMs for TTYH3 Antibody (NBP1-91350)

Learn more about PTMs related to TTYH3 Antibody (NBP1-91350).

Blogs on TTYH3

There are no specific blogs for TTYH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
11/30/2015
Application: Flow
Species: Human

Bioinformatics

Gene Symbol TTYH3
Uniprot