TSSK2 Antibody


Western Blot: TSSK2 Antibody [NBP1-52968] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TSSK2 Antibody Summary

Synthetic peptides corresponding to TSSK2(testis-specific serine kinase 2) The peptide sequence was selected from the middle region of TSSK2. Peptide sequence RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TSSK2 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TSSK2 Antibody

  • DGSG
  • DiGeorge syndrome protein G
  • EC 2.7.11
  • FLJ38613
  • serine/threonine kinase 22B (spermiogenesis associated)
  • Serine/threonine-protein kinase 22B
  • spermiogenesis associated 2
  • testis specific serine threonine kinase 2
  • Testis-specific kinase 2
  • testis-specific serine kinase 2
  • testis-specific serine/threonine-protein kinase 2
  • TSK-2
  • TSSK-2


TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt, Po, Bv, Fe, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB

Publications for TSSK2 Antibody (NBP1-52968) (0)

There are no publications for TSSK2 Antibody (NBP1-52968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSSK2 Antibody (NBP1-52968) (0)

There are no reviews for TSSK2 Antibody (NBP1-52968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSSK2 Antibody (NBP1-52968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TSSK2 Products

Bioinformatics Tool for TSSK2 Antibody (NBP1-52968)

Discover related pathways, diseases and genes to TSSK2 Antibody (NBP1-52968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSSK2 Antibody (NBP1-52968)

Discover more about diseases related to TSSK2 Antibody (NBP1-52968).

Pathways for TSSK2 Antibody (NBP1-52968)

View related products by pathway.

PTMs for TSSK2 Antibody (NBP1-52968)

Learn more about PTMs related to TSSK2 Antibody (NBP1-52968).

Research Areas for TSSK2 Antibody (NBP1-52968)

Find related products by research area.

Blogs on TSSK2

There are no specific blogs for TSSK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TSSK2 Antibody and receive a gift card or discount.


Gene Symbol TSSK2