TRUB1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRUB1 Antibody [NBP2-55729] - Staining of human cell line A-431 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRUB1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KLLSLSGVFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIGSGTKMLTSMLSGSKRYTAIGELGK
Specificity
Specificity of human TRUB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRUB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRUB1 Recombinant Protein Antigen (NBP2-55729PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TRUB1 Antibody

  • EC 5.4.99
  • EC 5.4.99.-
  • PUS4probable tRNA pseudouridine synthase 1
  • TruB pseudouridine (psi) synthase homolog 1 (E. coli)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55852
Species: Hu
Applications: WB, ICC/IF
NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85560
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32902
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48941
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-66865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC

Publications for TRUB1 Antibody (NBP2-55729) (0)

There are no publications for TRUB1 Antibody (NBP2-55729).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRUB1 Antibody (NBP2-55729) (0)

There are no reviews for TRUB1 Antibody (NBP2-55729). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRUB1 Antibody (NBP2-55729) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRUB1 Products

Bioinformatics Tool for TRUB1 Antibody (NBP2-55729)

Discover related pathways, diseases and genes to TRUB1 Antibody (NBP2-55729). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRUB1 Antibody (NBP2-55729)

Discover more about diseases related to TRUB1 Antibody (NBP2-55729).
 

Pathways for TRUB1 Antibody (NBP2-55729)

View related products by pathway.

Blogs on TRUB1

There are no specific blogs for TRUB1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRUB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRUB1