TRPM5 Antibody

Western Blot: TRPM5 Antibody [NBP2-48760] - Analysis in control (vector only transfected HEK293T lysate) and TRPM5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: TRPM5 Antibody [NBP2-48760] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Product Discontinued

TRPM5 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KEAEHKREHLERDLPDPLDQKVVTWETVQKENFLSKMEKRRRDSEGEVLRKTAHRVDFIAKYLGGLREQEKRIKCLESQINYCSVLV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRPM5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse (87%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRPM5 Antibody

• Long transient receptor potential channel 5
• LTrpC5
• LTrpC-5
• LTRPC5transient receptor potential cation channel subfamily M member 5
• MLSN1- and TRP-related gene 1 protein
• MTR1MLSN1 and TRP-related
• transient receptor potential cation channel, subfamily M, member 5

Background

TRPM5, transient receptor potential cation channel, subfamily M, member 5, is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRPM5