TRPM5 Antibody

Images

 
Western Blot: TRPM5 Antibody [NBP2-48760] - Analysis in control (vector only transfected HEK293T lysate) and TRPM5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TRPM5 Antibody [NBP2-48760] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRPM5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KEAEHKREHLERDLPDPLDQKVVTWETVQKENFLSKMEKRRRDSEGEVLRKTAHRVDFIAKYLGGLREQEKRIKCLESQINYCSVLV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRPM5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRPM5 Recombinant Protein Antigen (NBP2-48760PEP)

Reactivity Notes

Mouse (87%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRPM5 Antibody

  • Long transient receptor potential channel 5
  • LTrpC5
  • LTrpC-5
  • LTRPC5transient receptor potential cation channel subfamily M member 5
  • MLSN1- and TRP-related gene 1 protein
  • MTR1MLSN1 and TRP-related
  • transient receptor potential cation channel, subfamily M, member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-48036
Species: Ca, Hu, Pm, Pm
Applications: IHC, IHC-P, WB
NB100-1617
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-97311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-58415
Species: Hu
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DCLU00
Species: Hu
Applications: ELISA
NBP2-12906
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
NLS5060
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-40763
Species: Gp, Hu, Mu, Rt, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF2364
Species: Hu
Applications: IHC, WB
NB110-74960
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05122
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-48760
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TRPM5 Antibody (NBP2-48760) (0)

There are no publications for TRPM5 Antibody (NBP2-48760).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRPM5 Antibody (NBP2-48760) (0)

There are no reviews for TRPM5 Antibody (NBP2-48760). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRPM5 Antibody (NBP2-48760) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRPM5 Products

Bioinformatics Tool for TRPM5 Antibody (NBP2-48760)

Discover related pathways, diseases and genes to TRPM5 Antibody (NBP2-48760). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRPM5 Antibody (NBP2-48760)

Discover more about diseases related to TRPM5 Antibody (NBP2-48760).
 

Pathways for TRPM5 Antibody (NBP2-48760)

View related products by pathway.

PTMs for TRPM5 Antibody (NBP2-48760)

Learn more about PTMs related to TRPM5 Antibody (NBP2-48760).
 

Research Areas for TRPM5 Antibody (NBP2-48760)

Find related products by research area.

Blogs on TRPM5.

Winter is coming, and TRPM8 welcomes the cold!
TRPM8, or transient receptor potential melastatin 8, is a nonselective cation channel that is activated by cold environments and menthol-like cooling compounds.  While TRPM8 is best known for its location in peripheral nerve endings, it has functio...  Read full blog post.

Bitter Taste Receptor Antibodies Used in New Bronchodilator Study
As one of the world's leading antibody suppliers, Novus Biologicals has an expansive GPCR (G-protein coupled receptor) antibody catalog. Novus antibodies to the bitter taste receptor (TAS2R) have recently been used in a study on TAS2R bronchodilator a...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRPM5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRPM5