Tripeptidyl-Peptidase I/TPP1 Recombinant Protein Antigen

Images

 
There are currently no images for Tripeptidyl-Peptidase I/TPP1 Protein (NBP1-85561PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tripeptidyl-Peptidase I/TPP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TPP1.

Source: E. coli

Amino Acid Sequence: GCWSVSGRHQFRPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISGGGFSNVFPRPSYQEEAVTKFLSSSPHLPPSSYFNASGRAYPDVAALSDGYW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TPP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85561.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tripeptidyl-Peptidase I/TPP1 Recombinant Protein Antigen

  • Cell growth-inhibiting gene 1 protein
  • ceroid-lipofuscinosis, neuronal 2, late infantile (Jansky-Bielschowsky disease)
  • CLN2
  • CLN2EC 3.4.14.9
  • growth-inhibiting protein 1
  • LINCL
  • LPIC
  • lysosomal pepstatin insensitive protease
  • Lysosomal pepstatin-insensitive protease
  • MGC21297
  • TPP1
  • TPP-1
  • TPP-I
  • Tripeptidyl aminopeptidase
  • tripeptidyl peptidase I
  • tripeptidyl-peptidase 1
  • TripeptidylPeptidase I
  • Tripeptidyl-Peptidase I

Background

TPP1 encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45388
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-47582
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-87974
Species: Hu
Applications: IHC,  IHC-P, WB
NB600-241
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IM, KD, Simple Western, WB
NB500-176
Species: Hu
Applications: WB
NBP1-94150
Species: Hu
Applications: IHC,  IHC-P, WB
NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-39066
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-92342
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP3-45024
Species: Hu, Mu, Rt
Applications: IHC, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00065057-M02
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-292
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-85561PEP
Species: Hu
Applications: AC

Publications for Tripeptidyl-Peptidase I/TPP1 Protein (NBP1-85561PEP) (0)

There are no publications for Tripeptidyl-Peptidase I/TPP1 Protein (NBP1-85561PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tripeptidyl-Peptidase I/TPP1 Protein (NBP1-85561PEP) (0)

There are no reviews for Tripeptidyl-Peptidase I/TPP1 Protein (NBP1-85561PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tripeptidyl-Peptidase I/TPP1 Protein (NBP1-85561PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tripeptidyl-Peptidase I/TPP1 Products

Research Areas for Tripeptidyl-Peptidase I/TPP1 Protein (NBP1-85561PEP)

Find related products by research area.

Blogs on Tripeptidyl-Peptidase I/TPP1

There are no specific blogs for Tripeptidyl-Peptidase I/TPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tripeptidyl-Peptidase I/TPP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TPP1