![Western Blot: TRIML1 Antibody [H00339976-D01P] - Analysis of TRIML1 expression in transfected 293T cell line by TRIML1 polyclonal antibody.Lane 1: TRIML1 transfected lysate(21.40 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TRIML1-Antibody-Western-Blot-H00339976-D01P-img0001.jpg "Western Blot: TRIML1 Antibody [H00339976-D01P] - Analysis of TRIML1 expression in transfected 293T cell line by TRIML1 polyclonal antibody.Lane 1: TRIML1 transfected lysate(21.40 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | TRIML1 (AAH15684.1, 1 a.a. - 192 a.a.) full-length human protein. MKEMLRKFSTEITLDPATANAYLVLSEDLKSVKYGGSRQQLPDNPERFDQSATVLGTQIFTSGRHYWEVEVGNKTEWEVGICKDSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAFYNGTDESLIYSFPQASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRIML1 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TRIML1 Antibody (H00339976-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TRIML1 |
| Uniprot |
|
![Immunocytochemistry SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Immunocytochemistry_15995.jpg)
![Western Blot SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Western_Blot_21580.jpg)
![Simple Western SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Simple_Western_22563.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")