TRIM61 Antibody Summary
| Immunogen |
TRIM61 (NP_001012414, 110 a.a. - 208 a.a.) partial recombinant protein with GST tag. KDLELLCPRCSLSTDHQHHCVWPIKKAASYHRKKLEEYNAPWKERVELIEKVITMQTRKSLELKKKMESPSVTRLECSCTISAHFNLRLPGSSDSSASG |
| Specificity |
TRIM61 - tripartite motif-containing 61 |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
TRIM61 |
| Purity |
Unpurified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
50% Glycerol |
| Preservative |
No Preservative |
| Purity |
Unpurified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TRIM61 Antibody
Background
TRIM61 - tripartite motif-containing 61
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, ChHa, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AgAct, ICC, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: WB, ELISA
Publications for TRIM61 Antibody (H00391712-A01) (0)
There are no publications for TRIM61 Antibody (H00391712-A01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRIM61 Antibody (H00391712-A01) (0)
There are no reviews for TRIM61 Antibody (H00391712-A01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TRIM61 Antibody (H00391712-A01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TRIM61 Products
Research Areas for TRIM61 Antibody (H00391712-A01)
Find related products by research area.
|
Blogs on TRIM61