We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TRIM23 Recombinant Protein Antigen

Images

 
There are currently no images for TRIM23 Protein (NBP1-88846PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRIM23 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM23.

Source: E. coli

Amino Acid Sequence: LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRIM23
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88846.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRIM23 Recombinant Protein Antigen

  • ADP-ribosylation factor domain protein 1, 64kDa
  • ADP-ribosylation factor domain-containing protein 1
  • ARD1GTP-binding protein ARD-1
  • ARF domain protein 1
  • ARFD1
  • E3 ubiquitin-protein ligase TRIM23
  • EC 6.3.2.-
  • RNF46RING finger protein 46
  • tripartite motif containing 23
  • tripartite motif protein TRIM23
  • tripartite motif-containing 23
  • Tripartite motif-containing protein 23

Background

TRIM23 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein is also a member of the ADP ribosylation factor family of guanine nucleotide-binding family of proteins. Its carboxy terminus contains an ADP-ribosylation factor domain and a guanine nucleotide binding site, while the amino terminus contains a GTPase activating protein domain which acts on the guanine nucleotide binding site. The protein localizes to lysosomes and the Golgi apparatus. It plays a role in the formation of intracellular transport vesicles, their movement from one compartment to another, and phopholipase D activation. Three alternatively spliced transcript variants for this gene have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19461
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
NBP1-21387
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-13641
Species: Hu
Applications: IHC,  IHC-P
NBP3-45311
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
NBP3-52071
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP1-81010
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-64874
Species: Mu
Applications: Flow, IHC, IHC-Fr,  IHC-P
NBP2-14998
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-29906
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-22513
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-78983
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB (-)
NBP1-76879
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-15299
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00051127-M01
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB

Publications for TRIM23 Protein (NBP1-88846PEP) (0)

There are no publications for TRIM23 Protein (NBP1-88846PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM23 Protein (NBP1-88846PEP) (0)

There are no reviews for TRIM23 Protein (NBP1-88846PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRIM23 Protein (NBP1-88846PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM23 Products

Array NBP1-88846PEP

Research Areas for TRIM23 Protein (NBP1-88846PEP)

Find related products by research area.

Blogs on TRIM23

There are no specific blogs for TRIM23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRIM23 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM23