TRBP Recombinant Protein Antigen

Images

 
There are currently no images for TRBP Recombinant Protein Antigen (NBP2-49334PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRBP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRBP.

Source: E. coli

Amino Acid Sequence: PSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TARBP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49334.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRBP Recombinant Protein Antigen

  • LOQS
  • RISC-loading complex subunit TARBP2
  • TAR (HIV) RNA binding protein 2
  • TAR (HIV) RNA-binding protein 2
  • TAR (HIV) RNA-binding protein TRBP1
  • TAR (HIV-1) RNA binding protein 2
  • TAR RNA binding protein 2
  • TAR RNA-binding protein 2
  • trans-activation responsive RNA-binding protein
  • Trans-activation-responsive RNA-binding protein
  • TRBP
  • TRBP1
  • TRBP2

Background

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene also has a pseudogene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06520
Species: Hu, Mu
Applications: IP, KO, WB
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB200-335
Species: Hu
Applications: IHC,  IHC-P, IP, WB
MAB1980
Species: Hu
Applications: ICC, IP, Simple Western, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP2-48860
Species: Hu, Mu
Applications: IHC,  IHC-P
NBP1-79286
Species: Rt
Applications: WB
H00008575-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, WB
NB100-56648
Species: Hu, Mu, Rt
Applications: WB
NBP1-49535
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
H00057510-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP1-03349
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBA1-19349
Species: Mu
Applications: Flow, ICC/IF, In vitro, In vivo
NBP3-05509
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2574
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-15345
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-80896
Species: Hu
Applications: IHC,  IHC-P

Publications for TRBP Recombinant Protein Antigen (NBP2-49334PEP) (0)

There are no publications for TRBP Recombinant Protein Antigen (NBP2-49334PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRBP Recombinant Protein Antigen (NBP2-49334PEP) (0)

There are no reviews for TRBP Recombinant Protein Antigen (NBP2-49334PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRBP Recombinant Protein Antigen (NBP2-49334PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRBP Products

Research Areas for TRBP Recombinant Protein Antigen (NBP2-49334PEP)

Find related products by research area.

Blogs on TRBP

There are no specific blogs for TRBP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRBP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TARBP2