TRAPPC8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRAPPC8 Antibody [NBP1-93708] - Staining of human cell line U-2 OS shows localization to cytosol & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TRAPPC8 Antibody [NBP1-93708] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAPPC8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DYDLNISATTPWFESYRETFLQSMPASDHEFLNHYLACMLVASSSEAEPVEQFSKLSQEQHRIQHNSDYSYPKWFIPNTLKYYVLLHDVSAGDE
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAPPC8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRAPPC8 Protein (NBP1-93708PEP)
Publications
Read Publication using NBP1-93708.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAPPC8 Antibody

  • MGC71660
  • trafficking protein particle complex 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NB100-55735
Species: Bv, Ca, Ch, Hu, Mu, Pm
Applications: ICC/IF, IP, WB
NBP1-55113
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
NBP2-93565
Species: Hu, Mu
Applications: WB
NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00007109-M01
Species: Hu
Applications: ELISA, KD, WB
NBP1-55202
Species: Hu
Applications: IHC, IHC-P, WB
H00060684-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00056903-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-45955
Species: Hu
Applications: IHC, WB
NBP2-94046
Species: Mu, Rt
Applications: ICC/IF, WB
H00051112-B01P
Species: Hu
Applications: ICC/IF, WB
H00006218-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-24530
Species: Bv, Hu, Mu, Rt
Applications: Flow-IC, IHC, IHC-P, WB

Publications for TRAPPC8 Antibody (NBP1-93708)(1)

Reviews for TRAPPC8 Antibody (NBP1-93708) (0)

There are no reviews for TRAPPC8 Antibody (NBP1-93708). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TRAPPC8 Antibody (NBP1-93708) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRAPPC8 Products

Bioinformatics Tool for TRAPPC8 Antibody (NBP1-93708)

Discover related pathways, diseases and genes to TRAPPC8 Antibody (NBP1-93708). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAPPC8 Antibody (NBP1-93708)

Discover more about diseases related to TRAPPC8 Antibody (NBP1-93708).
 

Pathways for TRAPPC8 Antibody (NBP1-93708)

View related products by pathway.

Blogs on TRAPPC8

There are no specific blogs for TRAPPC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAPPC8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAPPC8