Recombinant Human TRAF3IP3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRAF3IP3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 231-330 of Human TRAF3IP3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NQLYTCTQKYSPWGMKKVLLEMEDQKNSYEQKAKESLQKVLEEKMNAEQQLQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSKL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRAF3IP3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRAF3IP3 Protein

  • DJ434O14.3
  • FLJ44151
  • MGC117354
  • MGC163289
  • T3JAMTRAF3-interacting protein 3
  • TRAF3 interacting Jun N terminal kinase (JNK) activating modulator
  • TRAF3 interacting protein 3
  • TRAF3-interacting JNK-activating modulator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56654
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-54692
Species: Hu, Mu, Rt
Applications: WB, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NB300-130
Species: Hu, Mu, Rt, Bv, Ce, Ch, Dr, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01438
Species: Hu
Applications: WB, IHC, IHC-P
NB100-59826
Species: Hu
Applications: WB, Simple Western, IP
NBP1-84869
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82182
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31566
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-14847
Species: Hu, Pm
Applications: IHC, IHC-P
NBP1-81052
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85342
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00085015-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-56638
Species: Hu
Applications: WB

Publications for TRAF3IP3 Partial Recombinant Protein (H00080342-Q01) (0)

There are no publications for TRAF3IP3 Partial Recombinant Protein (H00080342-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAF3IP3 Partial Recombinant Protein (H00080342-Q01) (0)

There are no reviews for TRAF3IP3 Partial Recombinant Protein (H00080342-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAF3IP3 Partial Recombinant Protein (H00080342-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAF3IP3 Products

TRAF3IP3 H00080342-Q01

Bioinformatics Tool for TRAF3IP3 Partial Recombinant Protein (H00080342-Q01)

Discover related pathways, diseases and genes to TRAF3IP3 Partial Recombinant Protein (H00080342-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAF3IP3 Partial Recombinant Protein (H00080342-Q01)

Discover more about diseases related to TRAF3IP3 Partial Recombinant Protein (H00080342-Q01).
 

Pathways for TRAF3IP3 Partial Recombinant Protein (H00080342-Q01)

View related products by pathway.

Blogs on TRAF3IP3

There are no specific blogs for TRAF3IP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRAF3IP3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAF3IP3