Torsin 1B Antibody

Images

 
Western Blot: Torsin 1B Antibody [NBP1-69580] - This Anti-TOR1B antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Torsin 1B Antibody Summary

Immunogen
Synthetic peptides corresponding to TOR1B(torsin family 1, member B (torsin B)) The peptide sequence was selected from the C terminal of TOR1B. Peptide sequence VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID (NP_055321).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOR1B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TOR1B and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Torsin 1B Antibody

  • DQ1MGC4386
  • Torsin family 1 member B
  • torsin family 1, member B (torsin B)
  • torsin-1B

Background

TOR1B may serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56137
Species: Hu
Applications: ICC/IF
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
H00003125-B02P
Species: Hu
Applications: WB, Flow
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for Torsin 1B Antibody (NBP1-69580) (0)

There are no publications for Torsin 1B Antibody (NBP1-69580).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Torsin 1B Antibody (NBP1-69580) (0)

There are no reviews for Torsin 1B Antibody (NBP1-69580). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Torsin 1B Antibody (NBP1-69580) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Torsin 1B Products

Bioinformatics Tool for Torsin 1B Antibody (NBP1-69580)

Discover related pathways, diseases and genes to Torsin 1B Antibody (NBP1-69580). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Torsin 1B Antibody (NBP1-69580)

Discover more about diseases related to Torsin 1B Antibody (NBP1-69580).
 

Pathways for Torsin 1B Antibody (NBP1-69580)

View related products by pathway.

PTMs for Torsin 1B Antibody (NBP1-69580)

Learn more about PTMs related to Torsin 1B Antibody (NBP1-69580).

Blogs on Torsin 1B

There are no specific blogs for Torsin 1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Torsin 1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOR1B
Entrez
Uniprot