TOR/mTOR Recombinant Protein Antigen

Images

 
There are currently no images for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TOR/mTOR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TOR/mTOR.

Source: E.coli

Amino Acid Sequence: TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MTOR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55920 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TOR/mTOR Recombinant Protein Antigen

  • EC 2.7.11.1
  • FK506 binding protein 12-rapamycin associated protein 1
  • FK506 binding protein 12-rapamycin associated protein 2
  • FK506-binding protein 12-rapamycin complex-associated protein 1
  • FKBP12-rapamycin complex-associated protein
  • FLJ44809
  • FRAP
  • FRAP1
  • FRAP1FKBP12-rapamycin complex-associated protein 1
  • FRAP2
  • Mammalian target of rapamycin
  • mechanistic target of rapamycin (serine/threonine kinase)
  • Mechanistic target of rapamycin
  • MTOR
  • RAFT1
  • rapamycin and FKBP12 target 1
  • rapamycin associated protein FRAP2
  • Rapamycin target protein 1
  • RAPT1FKBP-rapamycin associated protein
  • serine/threonine-protein kinase mTOR
  • TOR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-46403
Species: Hu
Applications: IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46234
Species: Hu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55920PEP
Species: Hu
Applications: AC

Publications for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP) (0)

There are no publications for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP) (0)

There are no reviews for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOR/mTOR Products

Bioinformatics Tool for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP)

Discover related pathways, diseases and genes to TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP)

Discover more about diseases related to TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP).
 

Pathways for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP)

View related products by pathway.

PTMs for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP)

Learn more about PTMs related to TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP).
 

Research Areas for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP)

Find related products by research area.

Blogs on TOR/mTOR.

Thomson Reuters Predicts 2016 Nobel Prize Winners
Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro...  Read full blog post.

mTOR - a central regulator of cell metabolism
The mammalian target of rapamycin (mTOR) signaling pathway allows cells to monitor environmental signals like nutrient availability and oxygen levels. mTOR is a phosphoinositide 3-kinase (PI3K)-related protein that assembles into large protein comp...  Read full blog post.

Customers Who Bought This Also Bought

4EBP1 Antibody
NB200-157

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TOR/mTOR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MTOR
Entrez