TOR/mTOR Recombinant Protein Antigen

Images

 
There are currently no images for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TOR/mTOR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TOR/mTOR.

Source: E. coli

Amino Acid Sequence: TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MTOR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55920.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TOR/mTOR Recombinant Protein Antigen

  • EC 2.7.11.1
  • FK506 binding protein 12-rapamycin associated protein 1
  • FK506 binding protein 12-rapamycin associated protein 2
  • FK506-binding protein 12-rapamycin complex-associated protein 1
  • FKBP12-rapamycin complex-associated protein
  • FLJ44809
  • FRAP
  • FRAP1
  • FRAP1FKBP12-rapamycin complex-associated protein 1
  • FRAP2
  • Mammalian target of rapamycin
  • mechanistic target of rapamycin (serine/threonine kinase)
  • Mechanistic target of rapamycin
  • MTOR
  • RAFT1
  • rapamycin and FKBP12 target 1
  • rapamycin associated protein FRAP2
  • Rapamycin target protein 1
  • RAPT1FKBP-rapamycin associated protein
  • serine/threonine-protein kinase mTOR
  • TOR

Background

The mammalian target of rapamycin (mTOR) is a serine/threonine protein kinase which helps to mediate many cellular processes. Specifically, mTOR is invloved in the cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex, making mTOR antibodies useful tools for a number of important research areas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-1595
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NB200-157
Species: Hu
Applications: IHC,  IHC-P, KO, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-1049
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-67552
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-91228
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-46234
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-55920PEP
Species: Hu
Applications: AC

Publications for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP) (0)

There are no publications for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP) (0)

There are no reviews for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOR/mTOR Products

Research Areas for TOR/mTOR Recombinant Protein Antigen (NBP2-55920PEP)

Find related products by research area.

Blogs on TOR/mTOR.

Staufen1 Overabundance and the Consequent mTOR Hyperactivity in Amyotrophic Lateral Sclerosis, Spinocerebellar Ataxia Type 2, Alzheimer’s, Parkinson’s, and Huntington’s Diseases
Jamshed Arslan, Pharm D, PhD Neurodegenerative disorders involve loss of function and, ultimately, death of neurons. Selective neuronal vulnerability has been observed in a variety of neurodegenerative diseases. Fo...  Read full blog post.

mTOR Signaling and the Tumor Microenvironment
By Yoskaly Lazo-Fernandez, PhD The mammalian target of rapamycin (mTOR) is a conserved serine/threonine kinase that, as a member of two distinct intracellular protein complexes, mTORC1 and mTORC2, regulates protein ...  Read full blog post.

The Many Connections Between Autophagy and Kidney Disease
By Yoskaly Lazo-Fernandez, PhD The first description of what is called today an autophagosome was given in a paper published in 1957. Its author employed electron microscopy to observe the neonatal features of mous...  Read full blog post.

Thomson Reuters Predicts 2016 Nobel Prize Winners
Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro...  Read full blog post.

mTOR - a central regulator of cell metabolism
The mammalian target of rapamycin (mTOR) signaling pathway allows cells to monitor environmental signals like nutrient availability and oxygen levels. mTOR is a phosphoinositide 3-kinase (PI3K)-related protein that assembles into large protein comp...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TOR/mTOR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MTOR