Home » TOMM22 » TOMM22 Antibodies » TOMM22 Antibody (4G4)

TOMM22 Antibody (4G4)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TOMM22 Antibody (4G4) [H00056993-M01] - TOMM22 monoclonal antibody (M01), clone 4G4 Analysis of TOMM22 expression in NIH/3T3.
Western Blot: TOMM22 Antibody (4G4) [H00056993-M01] - TOMM22 monoclonal antibody (M01), clone 4G4 Analysis of TOMM22 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: TOMM22 Antibody (4G4) [H00056993-M01] - Analysis of monoclonal antibody to TOMM22 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TOMM22 Antibody (4G4) [H00056993-M01] - Analysis of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: TOMM22 Antibody (4G4) [H00056993-M01] - Analysis of TOMM22 over-expressed 293 cell line, cotransfected with TOMM22 Validated Chimera RNAi ( Cat # H00056993-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: TOMM22 Antibody (4G4) [H00056993-M01] - TOMM22 monoclonal antibody (M01), clone 4G4. Analysis of TOMM22 expression in PC-12.
Western Blot: TOMM22 Antibody (4G4) [H00056993-M01] - TOMM22 monoclonal antibody (M01), clone 4G4. Analysis of TOMM22 expression in Raw 264.7.
Western Blot: TOMM22 Antibody (4G4) [H00056993-M01] - Analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody (M01), clone 4G4.Lane 1: TOMM22 transfected lysate(15.5 KDa).Lane 2: ...read more
Sandwich ELISA: TOMM22 Antibody (4G4) [H00056993-M01] - Detection limit for recombinant GST tagged TOMM22 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
Clone
4G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TOMM22 Antibody (4G4) Summary

Immunogen
TOMM22 (AAH09363, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Specificity
TOMM22 - translocase of outer mitochondrial membrane 22 homolog (yeast)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TOMM22
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), RNAi validation and ELISA.
Publications
Read Publication using H00056993-M01.

Reactivity Notes

Human, mouse & rat. Other species have not been tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TOMM22 Antibody (4G4)

  • 1C9-2
  • hTom22
  • mitochondrial import receptor subunit TOM22 homolog
  • mitochondrial import receptor Tom22
  • MST065
  • TOM22MSTP065
  • Translocase of outer membrane 22 kDa subunit homolog
  • translocase of outer mitochondrial membrane 22 homolog (yeast)

Background

The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TOMM20 Antibody
NBP1-81556
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human endometrium shows moderate to strong positivity in mitochondria in glandular cells.
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human prostate shows moderate to strong positivity in mitochondria in glandular cells.
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human cerebral cortex shows moderate to strong positivity in mitochondria in neurons.
(3 Reviews)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, Simple Western, WB
TOMM40 Antibody
NBP2-38289
Immunocytochemistry/Immunofluorescence: TOMM40 Antibody [NBP2-38289] - Staining of human cell line HEK 293 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human cerebral cortex shows weak granular positivity in cytoplasm in neurons.
Immunohistochemistry-Paraffin: TOMM40 Antibody [NBP2-38289] - Staining of human colon shows strong granular positivity in cytoplasm in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PRPF6 Antibody
NBP1-92298
Immunocytochemistry/Immunofluorescence: PRPF6 Antibody [NBP1-92298] - Staining of human cell line CACO-2 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PRPF6 Antibody [NBP1-92298] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: PRPF6 Antibody [NBP1-92298] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TIMM17A Antibody
NBP1-80681
Immunocytochemistry/Immunofluorescence: TIMM17A Antibody [NBP1-80681] - Staining of human cell line SiHa shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TIMM17A Antibody [NBP1-80681] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: TIMM17A Antibody [NBP1-80681] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TOMM7 Antibody
NBP3-12426
Western Blot: TOMM7 Antibody [NBP3-12426] - TOM-7 at various concentrations. 1:250 in antibody dilution in diluOBuffer.
Species: Bv, Hu, Mu, Po, Pm, Rt
Applications: ELISA, IP, WB
GIP Antibody
(911205) [Unconjugate
MAB8864
GIP was detected in immersion fixed paraffin-embedded sections of human stomach using Mouse Anti-Human GIP Monoclonal Antibody (Catalog # MAB8864) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to gastric glands. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: IHC
G protein alpha
Inhibitor 2 Antibody
NBP2-44318
Immunohistochemistry-Paraffin: G protein alpha Inhibitor 2 Antibody [NBP2-44318] - Staining of paraffin embedded Human Thyroid. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: G protein alpha Inhibitor 2 Antibody [NBP2-44318] - Staining of paraffin embedded Human Tonsil. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: G protein alpha Inhibitor 2 Antibody [NBP2-44318] - Analysis of human peripheral blood lymphocytes lysate (35 ug protein in RIPA buffer). Antibody at 2 ug/mL. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
C1qTNF1/CTRP1
Antibody - BSA Free
NBP1-76626
Immunofluorescence: C1qTNF1/CTRP1 Antibody [NBP1-76626] - Immunofluorescence of CTRP1 in Human Kidney cells with CTRP1 antibody at 20 ug/mL.
Western Blot: C1qTNF1/CTRP1 Antibody [NBP1-76626] - Analysis of CTRP1 in human kidney cell lysate with CTRP1 (NT) antibody using NBP1-76626 at (A) 1 and (B) 2 ug/ml.
Immunohistochemistry-Paraffin: C1qTNF1/CTRP1 Antibody [NBP1-76626] - Human kidney tissue with CTRP1 antibody at 10 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
Recombinant Human
TIM23 GST (N-Term) Pr ...
H00010431-P01
SDS-Page: Recombinant Human TIM23 Protein [H00010431-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Analysis of lysates from human metastatic pancreatic cancer cell line L3.6pl using Bax Antibody (clone 6A7; Lot # B168-P780E). This image was submitted via reviews by a varified end user.
Western Blot: Bax Antibody (6A7) [NBP1-28566] - rOPN administration elevated the expression of autophagy-related proteins while suppressing apoptosis in rat brain at 24 h after SAH. The effects of rOPN on expression levels of Bax, mean +/- SD is 1.006 +/- 0.321 in Sham group, 37.47 +/- 10.86 in SAH + Vehicle group, 23.83 +/- 8.143 in SAH + rOPN group, F = 33.13, in the left hemisphere of rat brain at 24 h after SAH. Sample size is 18, n = 6 per group. Data were presented as mean +/- SD. *P < .05, ***P < .001 vs Sham group; #P < .05, ##P < .01 vs SAH + Vehicle group Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/cns.13199) licensed under a CC-BY licence.
Immunohistochemistry-Frozen: Bax Antibody (6A7) [NBP1-28566] - Mouse retina with no pretreatment. IHC-F image submitted by a verified customer review
(3 Reviews)
(18 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
PBR Antibody
NB100-41398
Flow Cytometry: PBR Antibody [NB100-41398] - Flow cytometric analysis of paraformaldehyde fixed MCF7 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunocytochemistry/Immunofluorescence: PBR Antibody [NB100-41398] - Immunofluorescence analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative cLontrol: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody.
Immunocytochemistry/Immunofluorescence: PBR Antibody [NB100-41398] - Immunofluorescence analysis of paraformaldehyde fixed MCF7 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(12 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
TIMM50 Antibody
(0W6J4)
NBP3-15459
Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459] - Immunohistochemistry of paraffin-embedded rat kidney using TIMM50 Rabbit mAb (NBP3-15459) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459] - Immunohistochemistry of paraffin-embedded human liver using TIMM50 Rabbit mAb (NBP3-15459) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: TIMM50 Antibody (0W6J4) [NBP3-15459] - Immunohistochemistry of paraffin-embedded mouse pancreas using TIMM50 Rabbit mAb (NBP3-15459) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
VDAC1 Antibody
NB100-695
Western Blot: VDAC1 Antibody [NB100-695] - The BNIP3 C-terminus can be phosphorylated. Alkaline extraction of mitochondria-associated proteins, showing alkaline extract of the mitochondrial pellet and the alkaline-resistant mitochondrial pellet from cells expressing each BNIP3 phosphomutant. All blots are representative of at least 3 independent experiments. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0129667), licensed under a CC-BY licence.
Western Blot: VDAC1 Antibody [NB100-695] - The BNIP3 C-terminus can be phosphorylated. Subcellular localization of BNIP3 phosphomutants, showing Western blot of cytosolic and mitochondrial fractions. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0129667), licensed under a CC-BY licence.
Western Blot: VDAC1 Antibody [NB100-695] - Lane 1: rat heart whole cell lysate. Lane 2: none. Load: 35 ug per lane. Primary antibody: VDAC/Porin antibody at 1:1,200 for overnight at 4C. Secondary antibody: IRDye800 (TM) rabbit secondary antibody at 1:10,000 for 45 min at RT. Block: 5% BLOTTO overnight at 4C. Predicted/Observed size: ~32 kDa corresponding to VDAC/Porin (arrowhead).
(6 Publications)
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
HSP90 alpha
Antibody - BSA Free
NBP1-77685
Simple Western: HSP90 alpha Antibody [NBP1-77685] - Image shows a specific band for Hsp90A in 0.5 mg/mL of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
HspA4 Antibody
(SD0861)
NBP2-67817
Flow Cytometry: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of Hela cells with HSPA4 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CYP27A1 Antibody
NBP2-32433
Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Analysis in human liver and pancreas tissues. Corresponding CYP27A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for TOMM22 Antibody (H00056993-M01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00056993-M01 Applications Species
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for TOMM22 Antibody (H00056993-M01) (0)

There are no reviews for TOMM22 Antibody (H00056993-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOMM22 Antibody (H00056993-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOMM22 Products

Bioinformatics Tool for TOMM22 Antibody (H00056993-M01)

Discover related pathways, diseases and genes to TOMM22 Antibody (H00056993-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM22 Antibody (H00056993-M01)

Discover more about diseases related to TOMM22 Antibody (H00056993-M01).
 

Pathways for TOMM22 Antibody (H00056993-M01)

View related products by pathway.

Research Areas for TOMM22 Antibody (H00056993-M01)

Find related products by research area.

Blogs on TOMM22

There are no specific blogs for TOMM22, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOMM22 Antibody (4G4) and receive a gift card or discount.


Bioinformatics

Gene Symbol TOMM22
Entrez
OMIM
Uniprot