TOMM22 Antibody (4G4)

Images

 
Western Blot: TOMM22 Antibody (4G4) [H00056993-M01] - TOMM22 monoclonal antibody (M01), clone 4G4 Analysis of TOMM22 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: TOMM22 Antibody (4G4) [H00056993-M01] - Analysis of monoclonal antibody to TOMM22 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TOMM22 Antibody (4G4) [H00056993-M01] - Analysis of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Western Blot: TOMM22 Antibody (4G4) [H00056993-M01] - Analysis of TOMM22 over-expressed 293 cell line, cotransfected with TOMM22 Validated Chimera RNAi ( Cat # H00056993-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Western Blot: TOMM22 Antibody (4G4) [H00056993-M01] - TOMM22 monoclonal antibody (M01), clone 4G4. Analysis of TOMM22 expression in PC-12.
Western Blot: TOMM22 Antibody (4G4) [H00056993-M01] - TOMM22 monoclonal antibody (M01), clone 4G4. Analysis of TOMM22 expression in Raw 264.7.
Western Blot: TOMM22 Antibody (4G4) [H00056993-M01] - Analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody (M01), clone 4G4.Lane 1: TOMM22 transfected lysate(15.5 KDa).Lane 2: ...read more
Sandwich ELISA: TOMM22 Antibody (4G4) [H00056993-M01] - Detection limit for recombinant GST tagged TOMM22 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
Clone
4G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TOMM22 Antibody (4G4) Summary

Immunogen
TOMM22 (AAH09363, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Specificity
TOMM22 - translocase of outer mitochondrial membrane 22 homolog (yeast)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TOMM22
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), RNAi validation and ELISA.
Publications
Read Publication using H00056993-M01.

Reactivity Notes

Human, mouse & rat. Other species have not been tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TOMM22 Antibody (4G4)

  • 1C9-2
  • hTom22
  • mitochondrial import receptor subunit TOM22 homolog
  • mitochondrial import receptor Tom22
  • MST065
  • TOM22MSTP065
  • Translocase of outer membrane 22 kDa subunit homolog
  • translocase of outer mitochondrial membrane 22 homolog (yeast)

Background

The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-17193
Species: Hu
NBP3-04865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-44318
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3145
Species: Hu
Applications: WB
NBP1-28566
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, Func, IHC, IHC-Fr
NB100-41398
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-38791
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Bv, Fi
Applications: WB, ELISA, IHC, KD
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-76827
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for TOMM22 Antibody (H00056993-M01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00056993-M01 Applications Species
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for TOMM22 Antibody (H00056993-M01) (0)

There are no reviews for TOMM22 Antibody (H00056993-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOMM22 Antibody (H00056993-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TOMM22 Products

Bioinformatics Tool for TOMM22 Antibody (H00056993-M01)

Discover related pathways, diseases and genes to TOMM22 Antibody (H00056993-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM22 Antibody (H00056993-M01)

Discover more about diseases related to TOMM22 Antibody (H00056993-M01).
 

Pathways for TOMM22 Antibody (H00056993-M01)

View related products by pathway.

Research Areas for TOMM22 Antibody (H00056993-M01)

Find related products by research area.

Blogs on TOMM22

There are no specific blogs for TOMM22, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOMM22 Antibody (4G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol TOMM22
Entrez
OMIM
Uniprot