Recombinant Human TNNI3K Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TNNI3K Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 371-470 of Human TNNI3K partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEYSQPGGDGSYVSVPSPLGKIKSMTKEKADILLLRAGLPSHFHLQLSEIEFHEIIG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TNNI3K

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TNNI3K Protein

  • CARKCardiac ankyrin repeat kinase
  • EC 2.7.11.1
  • MGC142099
  • MGC33828
  • serine/threonine-protein kinase TNNI3K
  • TNNI3 interacting kinase
  • TNNI3-interacting kinase

Background

TNNI3K - TNNI3 interacting kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19777
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-33759
Species: Mu
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46034
Species: Hu, Ca, Mk
Applications: WB, IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-92093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00054814-B01P
Species: Hu
Applications: WB, ELISA
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB200-412
Species: Hu, Mu, Rt, Ca
Applications: IA, S-ELISA
NBP2-52737
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TNNI3K Partial Recombinant Protein (H00051086-Q01) (0)

There are no publications for TNNI3K Partial Recombinant Protein (H00051086-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNNI3K Partial Recombinant Protein (H00051086-Q01) (0)

There are no reviews for TNNI3K Partial Recombinant Protein (H00051086-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNNI3K Partial Recombinant Protein (H00051086-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TNNI3K Products

Bioinformatics Tool for TNNI3K Partial Recombinant Protein (H00051086-Q01)

Discover related pathways, diseases and genes to TNNI3K Partial Recombinant Protein (H00051086-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNNI3K Partial Recombinant Protein (H00051086-Q01)

Discover more about diseases related to TNNI3K Partial Recombinant Protein (H00051086-Q01).
 

Pathways for TNNI3K Partial Recombinant Protein (H00051086-Q01)

View related products by pathway.

PTMs for TNNI3K Partial Recombinant Protein (H00051086-Q01)

Learn more about PTMs related to TNNI3K Partial Recombinant Protein (H00051086-Q01).
 

Research Areas for TNNI3K Partial Recombinant Protein (H00051086-Q01)

Find related products by research area.

Blogs on TNNI3K

There are no specific blogs for TNNI3K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
TNNI3K Antibody
H00051086-D01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TNNI3K Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TNNI3K