Recombinant Human TNNI3K Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TNNI3K Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 371-470 of Human TNNI3K

Source: Wheat Germ

Amino Acid Sequence: CDPSRSSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPQDELPCNEYSQPGGDGSYVSVPSPLGKIKSMTKEKADILLLRAGLPSHFHLQLSEIEFHEIIG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TNNI3K
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TNNI3K Protein

  • CARKCardiac ankyrin repeat kinase
  • EC 2.7.11.1
  • MGC142099
  • MGC33828
  • serine/threonine-protein kinase TNNI3K
  • TNNI3 interacting kinase
  • TNNI3-interacting kinase

Background

TNNI3K - TNNI3 interacting kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67043
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, ChIP, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-14292
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33759
Species: Mu
Applications: WB, IHC, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46034
Species: Hu, Ca, Mk
Applications: WB, IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90558
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-66943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-77122
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82208
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
MAB9096
Species: Hu
Applications: WB, IHC

Publications for TNNI3K Partial Recombinant Protein (H00051086-Q01) (0)

There are no publications for TNNI3K Partial Recombinant Protein (H00051086-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNNI3K Partial Recombinant Protein (H00051086-Q01) (0)

There are no reviews for TNNI3K Partial Recombinant Protein (H00051086-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNNI3K Partial Recombinant Protein (H00051086-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TNNI3K Products

Bioinformatics Tool for TNNI3K Partial Recombinant Protein (H00051086-Q01)

Discover related pathways, diseases and genes to TNNI3K Partial Recombinant Protein (H00051086-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNNI3K Partial Recombinant Protein (H00051086-Q01)

Discover more about diseases related to TNNI3K Partial Recombinant Protein (H00051086-Q01).
 

Pathways for TNNI3K Partial Recombinant Protein (H00051086-Q01)

View related products by pathway.

PTMs for TNNI3K Partial Recombinant Protein (H00051086-Q01)

Learn more about PTMs related to TNNI3K Partial Recombinant Protein (H00051086-Q01).
 

Research Areas for TNNI3K Partial Recombinant Protein (H00051086-Q01)

Find related products by research area.

Blogs on TNNI3K

There are no specific blogs for TNNI3K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TNNI3K Antibody
H00051086-D01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TNNI3K Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TNNI3K