TNNC2 Antibody

Immunocytochemistry/Immunofluorescence: TNNC2 Antibody [NBP2-49282] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TNNC2 Antibody [NBP2-49282] - Staining in human skeletal muscle and heart muscle tissues using anti-TNNC2 antibody. Corresponding TNNC2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TNNC2 Antibody [NBP2-49282] - Staining of human heart muscle shows low expression as expected.

Immunohistochemistry-Paraffin: TNNC2 Antibody [NBP2-49282] - Staining of human skeletal muscle shows high expression.

Product Discontinued

TNNC2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ARSYLSEEMIAEFKAAFDMFDADGGGDISVKE
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNNC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TNNC2 Antibody

• skeletal muscle
• troponin C type 2 (fast)
• troponin C2, fast

Background

Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNNC2