TNIK Recombinant Protein Antigen

Images

 
There are currently no images for TNIK Protein (NBP1-82994PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TNIK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNIK.

Source: E.coli

Amino Acid Sequence: QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TNIK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82994.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TNIK Recombinant Protein Antigen

  • EC 2.7.11
  • KIAA0551EC 2.7.11.1
  • TRAF2 and NCK interacting kinase
  • TRAF2 and NCK-interacting protein kinase

Background

Northern analysis indicates TNIK expression in human heart, skeletal muscle, and brain, with lower levels of expression in kidney, liver, lung, and pancreas. ESTs have been isolated from human tissue libraries, including normal amnion, gallbladder, skin, and testis and cancerous bone, germ cell, nerve, and placenta.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009448-M07
Species: Bv, Hu, Pa
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-24574
Species: Ca, Ch, Eq, Hu, Mu, Ma-Op, Pm, Xp
Applications: IHC, IHC-P, WB
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-22990
Species: Hu, Mu
Applications: IP, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP1-87833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-33197
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-81166
Species: Hu
Applications: IHC, IHC-P
NBP2-33875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: Simple Western, WB
NB300-595
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB

Publications for TNIK Protein (NBP1-82994PEP) (0)

There are no publications for TNIK Protein (NBP1-82994PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNIK Protein (NBP1-82994PEP) (0)

There are no reviews for TNIK Protein (NBP1-82994PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TNIK Protein (NBP1-82994PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TNIK Products

Bioinformatics Tool for TNIK Protein (NBP1-82994PEP)

Discover related pathways, diseases and genes to TNIK Protein (NBP1-82994PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNIK Protein (NBP1-82994PEP)

Discover more about diseases related to TNIK Protein (NBP1-82994PEP).
 

Pathways for TNIK Protein (NBP1-82994PEP)

View related products by pathway.

PTMs for TNIK Protein (NBP1-82994PEP)

Learn more about PTMs related to TNIK Protein (NBP1-82994PEP).
 

Research Areas for TNIK Protein (NBP1-82994PEP)

Find related products by research area.

Blogs on TNIK

There are no specific blogs for TNIK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TCF4 Antibody (1G4)
H00006925-M03
MST3 Antibody
NBP1-87833

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TNIK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TNIK