TMEM65 Antibody - BSA Free

Staining of human cell line U-2 OS shows localization to nucleoplasm.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM65 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMEM65 Antibody - BSA Free (NBP1-85970) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-TMEM65 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM65
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: WB, ICC/IF reported in scientific literature (PMID: 26403541). ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TMEM65 Protein (NBP1-85970PEP)

Reactivity Notes

Rat (81%). Mouse reactivity reported in scientific literature (PMID: 26403541).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM65 Antibody - BSA Free

• transmembrane protein 65

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM65 Antibody (NBP1-85970)(1)

Publication using NBP1-85970

• Parveen Sharma, Cynthia Abbasi, Savo Lazic et al. Evolutionarily conserved intercalated disc protein Tmem65 regulates cardiac conduction and connexin 43 function. Nature Communications 2015-01-01 [PMID: 26403541] (WB, ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: TMEM65