TMEM48 Antibody

Immunocytochemistry/Immunofluorescence: TMEM48 Antibody [NBP2-57872] - Staining of human cell line RH-30 shows localization to nuclear membrane, plasma membrane & actin filaments. Antibody staining is shown in green.

Product Discontinued

TMEM48 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KLSTPDVVSPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRRGPRLWTSASDQQMTEFSNPSPSTSISAE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TMEM48 Antibody

• FLJ10407
• FLJ34120
• NDC1
• NET3
• transmembrane protein 48

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDC1