TMEM215 Antibody


Immunocytochemistry/ Immunofluorescence: TMEM215 Antibody [NBP2-14772] - Staining of human cell line U-2 OS shows localization to nucleoplasm & endoplasmic reticulum.
Immunohistochemistry-Paraffin: TMEM215 Antibody [NBP2-14772] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TMEM215 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PSGSSLTYSALDVKCSARDRSECPEPEDSIFFVPQDSIIVCSYKQNSPYD RYCCYINQIQGRWDHETI
Specificity of human TMEM215 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM215 Protein (NBP2-14772PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TMEM215 Antibody

  • TMEM215 transmembrane protein 215


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, TCS
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for TMEM215 Antibody (NBP2-14772) (0)

There are no publications for TMEM215 Antibody (NBP2-14772).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM215 Antibody (NBP2-14772) (0)

There are no reviews for TMEM215 Antibody (NBP2-14772). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM215 Antibody (NBP2-14772) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TMEM215 Products

TMEM215 NBP2-14772

Bioinformatics Tool for TMEM215 Antibody (NBP2-14772)

Discover related pathways, diseases and genes to TMEM215 Antibody (NBP2-14772). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM215

There are no specific blogs for TMEM215, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM215 Antibody and receive a gift card or discount.


Gene Symbol TMEM215