TMEM215 Antibody

Images

 
Immunohistochemistry-Paraffin: TMEM215 Antibody [NBP2-14772] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM215 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSGSSLTYSALDVKCSARDRSECPEPEDSIFFVPQDSIIVCSYKQNSPYD RYCCYINQIQGRWDHETI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM215
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM215 Protein (NBP2-14772PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM215 Antibody

  • TMEM215 transmembrane protein 215

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81821
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-33867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-15110
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-80837
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP2-46648
Species: Hu, Mu, Rt
Applications: IHC
NB100-56473
Species: Hu, Mu, Pm
Applications: WB, Simple Western
H00154043-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81260
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82896
Species: Hu
Applications: IHC, IHC-P
NBP2-14772
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for TMEM215 Antibody (NBP2-14772) (0)

There are no publications for TMEM215 Antibody (NBP2-14772).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM215 Antibody (NBP2-14772) (0)

There are no reviews for TMEM215 Antibody (NBP2-14772). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM215 Antibody (NBP2-14772) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM215 Products

TMEM215 NBP2-14772

Bioinformatics Tool for TMEM215 Antibody (NBP2-14772)

Discover related pathways, diseases and genes to TMEM215 Antibody (NBP2-14772). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM215

There are no specific blogs for TMEM215, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM215 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM215