TMED3 Antibody - BSA Free

Western Blot: TMED3 Antibody [NBP2-57648] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: TMED3 Antibody [NBP2-57648] - Staining of human cell line BJ shows localization to the Golgi apparatus. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMED3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMED3 Antibody - BSA Free (NBP2-57648) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DPQGNTIYRETKKQYDSFTYRAEVKGVYQF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMED3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TMED3 Recombinant Protein Antigen (NBP2-57648PEP)

Reactivity Notes

Mouse 80%, Rat 83%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TMED3 Antibody - BSA Free

• C15orf22
• chromosome 15 open reading frame 22
• integral type I protein
• Membrane protein p24B
• MGC133022
• P24B
• transmembrane emp24 domain containing 3
• transmembrane emp24 domain-containing protein 3
• transmembrane emp24 protein transport domain containing 3,1200002G13Rik

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMED3