Recombinant Human TLE6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TLE6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-449 of Human TLE6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MATRSSDWLRRPLGEDNQPETQLFWDKEPWFWHDTLTEQLWRIFAGVHDEKAKPRDRQQAPGLGQESKAPGSCDPGTDPCPEDASTPRPPEASSSPPEGSQDRNTSWGVVQEPPGRASRFLQSISWDPEDFEDAWKRPDALPGQSKRLAVPCKLEKMRILAHGELVLATAISSFTRHVFTCGRRGIKVWSLTGQVAEDRFPESHLPIQTPGAFLRTCLLSSNSRSLLTGGYNLASVSVWDLAAPSLHVKEQLPCAGLNCQALDANLDANLAFASFTSGVVRIWDLRDQSVVRDLKGYPDGVKSIVVKGYNIWTGGPDACLRCWDQRTIMKPLEYQFKSQIMSLSHSPQEDWVLLGMANGQQWLQSTSGSQRHMVGQKDSVILSVKFSPFGQWWASVGMDDFLGVYSMPAGTKVFEVPEMSPVTCCDVSSNNRLVVTGSGEHASVYQITY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TLE6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TLE6 Protein

  • GRG6FLJ14009
  • MGC14966
  • transducin-like enhancer of split 6 (E(sp1) homolog, Drosophila)
  • transducin-like enhancer protein 6

Background

TLE6( AAH20206, 1 a.a. - 450 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7216
Species: Hu
Applications: IHC
NBP2-46134
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-15140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76645
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00003131-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30646
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76289
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, ICC
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
MAB7650
Species: Mu
Applications: WB, IHC
NBP2-45545
Species: Hu
Applications: WB, IHC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91737
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IHC-WhMt
H00079816-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TLE6 Recombinant Protein (H00079816-P01) (0)

There are no publications for TLE6 Recombinant Protein (H00079816-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TLE6 Recombinant Protein (H00079816-P01) (0)

There are no reviews for TLE6 Recombinant Protein (H00079816-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TLE6 Recombinant Protein (H00079816-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TLE6 Products

Bioinformatics Tool for TLE6 Recombinant Protein (H00079816-P01)

Discover related pathways, diseases and genes to TLE6 Recombinant Protein (H00079816-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TLE6 Recombinant Protein (H00079816-P01)

Discover more about diseases related to TLE6 Recombinant Protein (H00079816-P01).
 

Pathways for TLE6 Recombinant Protein (H00079816-P01)

View related products by pathway.

Research Areas for TLE6 Recombinant Protein (H00079816-P01)

Find related products by research area.

Blogs on TLE6

There are no specific blogs for TLE6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TLE6 Antibody (2E4)
H00079816-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TLE6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TLE6