Recombinant Human Timeless Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Timeless Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1109-1207 of Human TIMELESS partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PELQPKVPGEQGSDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRYQIEDDED

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TIMELESS
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Timeless Protein

  • FLJ12640
  • hTIMTIMELESS1
  • TIM1protein timeless homolog
  • timeless (Drosophila) homolog
  • timeless homolog (Drosophila)
  • TIMFLJ20714

Background

TIMELESS - timeless homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2365
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
H00001195-B01P
Species: Hu
Applications: WB, ICC/IF
AF2929
Species: Hu
Applications: WB
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38860
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
H00008914-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Timeless Partial Recombinant Protein (H00008914-Q01) (0)

There are no publications for Timeless Partial Recombinant Protein (H00008914-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Timeless Partial Recombinant Protein (H00008914-Q01) (0)

There are no reviews for Timeless Partial Recombinant Protein (H00008914-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Timeless Partial Recombinant Protein (H00008914-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Timeless Products

Bioinformatics Tool for Timeless Partial Recombinant Protein (H00008914-Q01)

Discover related pathways, diseases and genes to Timeless Partial Recombinant Protein (H00008914-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Timeless Partial Recombinant Protein (H00008914-Q01)

Discover more about diseases related to Timeless Partial Recombinant Protein (H00008914-Q01).
 

Pathways for Timeless Partial Recombinant Protein (H00008914-Q01)

View related products by pathway.

PTMs for Timeless Partial Recombinant Protein (H00008914-Q01)

Learn more about PTMs related to Timeless Partial Recombinant Protein (H00008914-Q01).
 

Research Areas for Timeless Partial Recombinant Protein (H00008914-Q01)

Find related products by research area.

Blogs on Timeless

There are no specific blogs for Timeless, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Timeless Antibody
NB100-40853

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Timeless Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMELESS