THYN1 Recombinant Protein

Images

 
There are currently no images for THYN1 Protein (NBP1-49448).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications PAGE
Concentration
0.5 mg/ml

Order Details

THYN1 Recombinant Protein Summary

Description
A recombinant protein corresponding to amino acids 1 - 225 of THYN1.

Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPS

Preparation
Method
E.coli
Gene
THYN1
Purity
>95% pure by SDS-PAGE

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 20% glycerol, 100mM NaCl
Concentration
0.5 mg/ml
Purity
>95% pure by SDS-PAGE

Applications/Dilutions

Application Notes
The purity of this protein is > 95% by SDS-PAGE. Molecular weight is 27.8 kDa (245aa) confirmed by MALDI-TOF (molecular weight on SDS-PAGE will appear higher)

Reactivity Notes

Human.

Alternate Names for THYN1 Recombinant Protein

  • HSPC144
  • MDS012
  • MGC12187
  • THY28KD
  • THY28MY105
  • thymocyte nuclear protein 1
  • Thymocyte protein Thy28

Background

Thymocyte nuclear protein 1, also known THYN1, is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Also, THYN1 in the thymocytes was mainly localized in the nucleus, as recently demonstrated in lymphoma cells, indicating that the THYN1 resides in the nucleus, irrespective of the cyclic or resting stage of the cell cycle. Recombinant human THYN1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00091746-P01
Species: Hu
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-84792
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1573
Species: Hu
Applications: WB, IP
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IP, ChIP
MAB7650
Species: Mu
Applications: WB, IHC
NBP1-49448
Species: Hu
Applications: PAGE

Publications for THYN1 Protein (NBP1-49448) (0)

There are no publications for THYN1 Protein (NBP1-49448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THYN1 Protein (NBP1-49448) (0)

There are no reviews for THYN1 Protein (NBP1-49448). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for THYN1 Protein (NBP1-49448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional THYN1 Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for THYN1 Protein (NBP1-49448)

Discover related pathways, diseases and genes to THYN1 Protein (NBP1-49448). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THYN1 Protein (NBP1-49448)

Discover more about diseases related to THYN1 Protein (NBP1-49448).
 

Pathways for THYN1 Protein (NBP1-49448)

View related products by pathway.

Blogs on THYN1

There are no specific blogs for THYN1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our THYN1 Recombinant Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol THYN1

Customers Who Bought This Also Bought

THYN1 Antibody
NBP1-86942
THYN1 Antibody
NBP1-86942
THYN1 Antibody
NBP1-86942