THRSP Antibody (2F8)

Images

 
Immunohistochemistry-Paraffin: THRSP Antibody (2F8) [H00007069-M01] - Analysis of monoclonal antibody to THRSP on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
Sandwich ELISA: THRSP Antibody (2F8) [H00007069-M01] - Detection limit for recombinant GST tagged THRSP is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC-P
Clone
2F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

THRSP Antibody (2F8) Summary

Immunogen
THRSP (NP_003242.1, 1 a.a. - 84 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKV
Specificity
THRSP - thyroid hormone responsive (SPOT14 homolog, rat) (2F8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
THRSP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for THRSP Antibody (2F8)

  • lipogenic protein 1
  • Lpgp
  • LPGP1
  • S14
  • S14MGC21659
  • Spot 14 protein
  • SPOT14
  • SPOT14SPOT14 homolog
  • THRSP
  • thyroid hormone responsive (SPOT14 homolog, rat)
  • thyroid hormone responsive SPOT14 (rat) homolog
  • thyroid hormone responsive SPOT14
  • thyroid hormone responsive
  • thyroid hormone-inducible hepatic protein

Background

The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57365
Species: Hu
Applications: WB
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13262
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00006192-P01
Species: Hu
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for THRSP Antibody (H00007069-M01) (0)

There are no publications for THRSP Antibody (H00007069-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THRSP Antibody (H00007069-M01) (0)

There are no reviews for THRSP Antibody (H00007069-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for THRSP Antibody (H00007069-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional THRSP Products

Bioinformatics Tool for THRSP Antibody (H00007069-M01)

Discover related pathways, diseases and genes to THRSP Antibody (H00007069-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THRSP Antibody (H00007069-M01)

Discover more about diseases related to THRSP Antibody (H00007069-M01).
 

Pathways for THRSP Antibody (H00007069-M01)

View related products by pathway.

PTMs for THRSP Antibody (H00007069-M01)

Learn more about PTMs related to THRSP Antibody (H00007069-M01).

Blogs on THRSP

There are no specific blogs for THRSP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THRSP Antibody (2F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol THRSP
Entrez
Uniprot