THRSP Antibody (2F8) - Azide and BSA Free

Immunohistochemistry-Paraffin: THRSP Antibody (2F8) [H00007069-M01] - Analysis of monoclonal antibody to THRSP on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.

Sandwich ELISA: THRSP Antibody (2F8) [H00007069-M01] - Detection limit for recombinant GST tagged THRSP is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA, IHC
• Clone: 2F8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

THRSP Antibody (2F8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: THRSP (NP_003242.1, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKV
• Specificity: THRSP - thyroid hormone responsive (SPOT14 homolog, rat) (2F8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: THRSP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 3 ug/ml
  • Sandwich ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for THRSP Antibody (2F8) - Azide and BSA Free

• lipogenic protein 1
• Lpgp
• LPGP1
• S14
• S14MGC21659
• Spot 14 protein
• SPOT14
• SPOT14SPOT14 homolog
• THRSP
• thyroid hormone responsive (SPOT14 homolog, rat)
• thyroid hormone responsive SPOT14 (rat) homolog
• thyroid hormone responsive SPOT14
• thyroid hormone responsive
• thyroid hormone-inducible hepatic protein

Background

The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THRSP
• Entrez:
  • 7069(Human)
• Uniprot:
  • NP_003242(Human)