We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

THADA Recombinant Protein Antigen

Images

 
There are currently no images for THADA Protein (NBP2-38239PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

THADA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human THADA.

Source: E. coli

Amino Acid Sequence: MLCQLLPMQPVPESSDGLLTVEQVKEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEVLNRCPNVSLQKLPEQWLWSVLEEIKCSDPSSKLCATR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
THADA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38239.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for THADA Recombinant Protein Antigen

  • death receptor-interacting protein
  • FLJ21877
  • FLJ44016
  • FLJ44876
  • gene inducing thyroid adenomas protein
  • KIAA1767
  • thyroid adenoma associated
  • thyroid adenoma-associated protein

Background

THADA is a gene that codes for a protein that is expressed in many organs including the pancreas, thyroid, and testis, and has five isoforms, with lengths of 1953, 1632, 1897, 674, and 937 amino acids and weights of approximately 220, 183, 211, 76, and 105 kDa respectively. Current research is being done on several diseases and disorders related to this gene including adenoma, thyroiditis, polycystic ovary syndrome, cleft lip/palate, diabetes mellitus, Crohn's disease, prostate cancer, obesity, and prostatitis. THADA has also been shown to have interactions with PRKAA1 and UBC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13885
Species: Hu
Applications: Flow, ICC/IF,  IHC-P, IP, PA, WB
AF3735
Species: Hu
Applications: IHC, WB
MAB4734
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-82916
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-88540
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85589
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89680
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB7936
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32796
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00003087-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-84265
Species: Hu
Applications: IHC,  IHC-P
NBP1-28904
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-16285
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB

Publications for THADA Protein (NBP2-38239PEP) (0)

There are no publications for THADA Protein (NBP2-38239PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THADA Protein (NBP2-38239PEP) (0)

There are no reviews for THADA Protein (NBP2-38239PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for THADA Protein (NBP2-38239PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional THADA Products

Array NBP2-38239PEP

Research Areas for THADA Protein (NBP2-38239PEP)

Find related products by research area.

Blogs on THADA

There are no specific blogs for THADA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our THADA Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol THADA