Recombinant Human TGR5/GPBAR1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TGR5/GPBAR1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 330 of Human GPBAR1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
GPBAR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
62.04 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TGR5/GPBAR1 GST (N-Term) Protein

  • BG37
  • BG37hBG37
  • G protein-coupled bile acid receptor 1
  • GPBA
  • GPBAR1
  • GPCR19
  • GPR131
  • G-protein coupled bile acid receptor 1
  • G-protein coupled bile acid receptor BG37
  • G-protein coupled receptor GPCR19
  • M-BAR
  • M-BARhGPCR19
  • membrane bile acid receptor
  • Membrane-type receptor for bile acids
  • MGC40597
  • TGR5
  • TGR5GPCR

Background

GPBAR1( AAH33625, 1 a.a. - 331 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NLS2576
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
NLS5411
Species: Ha, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00151306-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TGR5/GPBAR1 Recombinant Protein (H00151306-P01) (0)

There are no publications for TGR5/GPBAR1 Recombinant Protein (H00151306-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TGR5/GPBAR1 Recombinant Protein (H00151306-P01) (0)

There are no reviews for TGR5/GPBAR1 Recombinant Protein (H00151306-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TGR5/GPBAR1 Recombinant Protein (H00151306-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TGR5/GPBAR1 Products

Bioinformatics Tool for TGR5/GPBAR1 Recombinant Protein (H00151306-P01)

Discover related pathways, diseases and genes to TGR5/GPBAR1 Recombinant Protein (H00151306-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TGR5/GPBAR1 Recombinant Protein (H00151306-P01)

Discover more about diseases related to TGR5/GPBAR1 Recombinant Protein (H00151306-P01).
 

Pathways for TGR5/GPBAR1 Recombinant Protein (H00151306-P01)

View related products by pathway.

PTMs for TGR5/GPBAR1 Recombinant Protein (H00151306-P01)

Learn more about PTMs related to TGR5/GPBAR1 Recombinant Protein (H00151306-P01).
 

Research Areas for TGR5/GPBAR1 Recombinant Protein (H00151306-P01)

Find related products by research area.

Blogs on TGR5/GPBAR1.

The TGR5 Receptor and metabolic disease
The bile acid-responsive G-protein-coupled receptor TGR5 is widely distributed across the human body - including the endocrine glands, adipocyte cells, muscles, immune organs, spinal cord, and the enteric nervous system. G protein coupled receptor...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TGR5/GPBAR1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPBAR1