Recombinant Human TGR5/GPBAR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TGR5/GPBAR1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 330 of Human GPBAR1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GPBAR1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TGR5/GPBAR1 Protein

  • BG37
  • BG37hBG37
  • G protein-coupled bile acid receptor 1
  • GPBA
  • GPBAR1
  • GPCR19
  • GPR131
  • G-protein coupled bile acid receptor 1
  • G-protein coupled bile acid receptor BG37
  • G-protein coupled receptor GPCR19
  • M-BAR
  • M-BARhGPCR19
  • membrane bile acid receptor
  • Membrane-type receptor for bile acids
  • MGC40597
  • TGR5
  • TGR5GPCR

Background

GPBAR1( AAH33625, 1 a.a. - 331 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
NBP2-46522
Species: Hu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for TGR5/GPBAR1 Recombinant Protein (H00151306-P01) (0)

There are no publications for TGR5/GPBAR1 Recombinant Protein (H00151306-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TGR5/GPBAR1 Recombinant Protein (H00151306-P01) (0)

There are no reviews for TGR5/GPBAR1 Recombinant Protein (H00151306-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TGR5/GPBAR1 Recombinant Protein (H00151306-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TGR5/GPBAR1 Products

Bioinformatics Tool for TGR5/GPBAR1 Recombinant Protein (H00151306-P01)

Discover related pathways, diseases and genes to TGR5/GPBAR1 Recombinant Protein (H00151306-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TGR5/GPBAR1 Recombinant Protein (H00151306-P01)

Discover more about diseases related to TGR5/GPBAR1 Recombinant Protein (H00151306-P01).
 

Pathways for TGR5/GPBAR1 Recombinant Protein (H00151306-P01)

View related products by pathway.

PTMs for TGR5/GPBAR1 Recombinant Protein (H00151306-P01)

Learn more about PTMs related to TGR5/GPBAR1 Recombinant Protein (H00151306-P01).
 

Research Areas for TGR5/GPBAR1 Recombinant Protein (H00151306-P01)

Find related products by research area.

Blogs on TGR5/GPBAR1.

The TGR5 Receptor and metabolic disease
The bile acid-responsive G-protein-coupled receptor TGR5 is widely distributed across the human body - including the endocrine glands, adipocyte cells, muscles, immune organs, spinal cord, and the enteric nervous system. G protein coupled receptor...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TGR5/GPBAR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPBAR1
Entrez