TFAP2D Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TFAP2D Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TFAP2D.
  
  

  Source: E. coli

  Amino Acid Sequence: TPAICAALSTFQTVLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRKTSEAAVKEGK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TFAP2D
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13428.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TFAP2D Recombinant Protein Antigen

• Activating enhancer-binding protein 2-delta
• AP-2 like
• AP2-delta
• TFAP2BL1activating enhancer binding protein 2 beta-like 1
• transcription factor AP-2 beta (activating enhancer binding protein 2beta)-like 1
• transcription factor AP-2 beta (activating enhancer-binding protein 2beta)-like 1
• transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
• Transcription factor AP-2-beta-like 1
• transcription factor AP-2-delta

Background

Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements toregulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activategenes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb andneural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC (Bysimilarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for TFAP2D Protein (NBP2-13428PEP). (Showing 1 - 1 of 1 FAQ).

1. Have any of your TFAP2 antibodies been tested for cross reactivity with the other TFAP2 proteins such as alpha, beta and epsilon? Have they been tested by immunostaining tissue?
   • A list of our TFAP2D antibodies can be found here. Our products are all guaranteed for the applications and species listed on the datasheet and are not expected to cross-react with any known proteins.

Bioinformatics

• Gene Symbol: TFAP2D