Recombinant Human Testisin/Prss21 Protein

Images

 
SDS-Page: Recombinant Human Testisin/Prss21 Protein [H00010942-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Testisin/Prss21 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-314 of Human PRSS21 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGARGALLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQSGMSQPDPSWPLLFFPLLWALPLLGPV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PRSS21

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Testisin/Prss21 Protein

  • EC 3.4.21
  • Eosinophil serine protease 1
  • ESP1EC 3.4.21.-
  • ESP-1serine protease from eosinophils
  • protease, serine, 21 (testisin)
  • Prss21
  • Serine protease 21
  • TEST1
  • TEST1testisin
  • Testisin

Background

This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Alternative splicing of this gene results in three transcript variants encoding three different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
MAB4457
Species: Hu, Mu, Rt
Applications: WB
AF4599
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP2-01679
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF1988
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP2-46648
Species: Hu, Mu, Rt
Applications: IHC
NBP2-33867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Testisin/Prss21 Recombinant Protein (H00010942-P01) (0)

There are no publications for Testisin/Prss21 Recombinant Protein (H00010942-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Testisin/Prss21 Recombinant Protein (H00010942-P01) (0)

There are no reviews for Testisin/Prss21 Recombinant Protein (H00010942-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Testisin/Prss21 Recombinant Protein (H00010942-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Testisin/Prss21 Products

Bioinformatics Tool for Testisin/Prss21 Recombinant Protein (H00010942-P01)

Discover related pathways, diseases and genes to Testisin/Prss21 Recombinant Protein (H00010942-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Testisin/Prss21 Recombinant Protein (H00010942-P01)

Discover more about diseases related to Testisin/Prss21 Recombinant Protein (H00010942-P01).
 

Pathways for Testisin/Prss21 Recombinant Protein (H00010942-P01)

View related products by pathway.

PTMs for Testisin/Prss21 Recombinant Protein (H00010942-P01)

Learn more about PTMs related to Testisin/Prss21 Recombinant Protein (H00010942-P01).

Blogs on Testisin/Prss21

There are no specific blogs for Testisin/Prss21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

APC Antibody
NB100-91662

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Testisin/Prss21 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRSS21
Entrez