New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » Testican 3/SPOCK3 » Testican 3/SPOCK3 Antibodies » Testican 3/SPOCK3 Antibody (1A10)

Testican 3/SPOCK3 Antibody (1A10)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: Testican 3/SPOCK3 Antibody (1A10) [H00050859-M01] - Detection limit for recombinant GST tagged SPOCK3 is 1 ng/ml as a capture antibody.
Sandwich ELISA: Testican 3/SPOCK3 Antibody (1A10) [H00050859-M01] - Detection limit for recombinant GST tagged SPOCK3 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
1A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Testican 3/SPOCK3 Antibody (1A10) Summary

Immunogen
SPOCK3 (NP_058646, 132 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKT
Specificity
Reacts with sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3.
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPOCK3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Testican 3/SPOCK3 Antibody (1A10)

  • CWCV, and Kazal-like domains proteoglycan 3
  • HSAJ1454
  • sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3
  • SPOCK3
  • TES-3
  • Testican 3
  • TICN3

Background

Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 encodes a member of a novel Ca(2+)-binding proteoglycan family.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Testican 1/SPOCK1
Antibody (316801)
MAB2327
Testican 1/SPOCK1 Antibody (316801)
(2 Publications)
Species: Hu
Applications: IP, WB
SPARC Antibody
[Unconjugated]
AF942
Western blot shows lysates of C2C12 mouse myoblast cell line and mouse placenta tissue. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse SPARC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF942) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SPARC at approximately 35-37 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SPARC/Osteonectin was detected in immersion fixed frozen sections of mouse embryo (E15) using Mouse SPARC/Osteonectin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF942) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to developing cartilage. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
SPARC was detected in immersion fixed C2C12 mouse myoblast cell line using Goat Anti-Mouse SPARC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF942) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to endoplasmic reticuli. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(20 Publications)
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Testican 2/SPOCK2
Antibody
AF2328
Western blot shows lysates of rat lung tissue. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Testican 2/SPOCK2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2328) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Testican 2/SPOCK2 at approximately 140 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu, Mu, Rt
Applications: IP, WB
SPARC-like
1/SPARCL1 Antibody [U ...
AF2728
SPARC‑like 1/SPARCL1 was detected in immersion fixed paraffin-embedded sections of human brain using Goat Anti-Human SPARC‑like 1/SPARCL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2728) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to neurons. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human lung tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human SPARC‑like 1/SPARCL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2728) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SPARC‑like 1/SPARCL1 at approximately 130 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
HL‑60 human acute promyelocytic leukemia cell line was stained with Goat Anti-Human SPARC‑like 1/SPARCL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2728, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).  To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin. 
(4 Reviews)
(5 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Calbindin D-28K
Antibody
NBP2-50028
Western Blot: Calbindin D-28K Antibody [NBP2-50028] - Analysis of different tissue lysates and recombinant protein solutions using chicken pAb to calbindin, NBP2-50028, dilution 1:5,000 in green: [1] protein standard (red), [2] rat cerebellum, [3] pig hippocampus, [4] cow cerebellum, [5] protein standard (red). Next lanes are full length recombinant human proteins, [6] Parvalbumin, [7] Calretinin, [8] Calbindin. Bands at 25kDa in tissue lysates and ~30 kDa in protein solutions correspond to calbindin, the recombinant form being slightly larger due to the presence of a His tag and other vector derived sequence. NBP2-50028 antibody specifically recognizes calbindin protein and does not react with the closely related proteins parvalbumin and calretinin.
Immunocytochemistry/Immunofluorescence: Calbindin D-28K Antibody [NBP2-50028] - Cultured mouse embryonic kidney stained with Calbindin antibody (1:200) and DAPI. Image from verified customer review.
Western Blot: Calbindin D-28K Antibody [NBP2-50028] - Analysis of rat brain lysate (left), 0.5 ug of His-tagged recombinant proteins (right) were probed with NBP2-50028 at 1:5,000. Lane 1: Parvalbumin, Lane 2: Calretinin, Lane 3: Calbindin.
(1 Review)
(6 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Recombinant Human IL-8/CXCL8 (Catalog # 208-IL) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR2 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human IL-8/CXCL8 (20 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208). The ND50 is typically0.08-0.4 µg/mL.
IL-8/CXCL8 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(10 Reviews)
(104 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Cholecystokinin
Antibody
NBP2-62664
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Analysis in human duodenum and skeletal muscle tissues using Anti-CCK antibody. Corresponding CCK RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
Recombinant Human
SCRG1 GST (N-Term) Pr ...
H00011341-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
CYP26A1 Antibody
(1E1D2)
NBP3-16627
Immunohistochemistry-Paraffin: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Human breast using CYP26A1 Rabbit mAb (NBP3-16627) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunocytochemistry/Immunofluorescence: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Immunofluorescence analysis of rat placenta cells using CYP26A1 Rabbit mAb (NBP3-16627) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Immunofluorescence analysis of human placenta cells using CYP26A1 Rabbit mAb (NBP3-16627) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TCF19 Antibody
(6D8)
H00006941-M01
Immunocytochemistry/Immunofluorescence: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 over-expressed 293 cell line, cotransfected with TCF19 Validated Chimera RNAi ( Cat # H00006941-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF19 monoclonal antibody (M01), clone 6D8 (Cat # H00006941-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
MMP-16/MT3-MMP
Antibody [Unconjugate
AF1785
MMP‑16/MT3‑MMP was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human MMP‑16/MT3‑MMP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1785) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: IHC, IP, WB
SPRR3 Antibody
NBP2-13374
Immunohistochemistry-Paraffin: SPRR3 Antibody [NBP2-13374] - Analysis in human esophagus and liver tissues using NBP2-13374 antibody. Corresponding SPRR3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SPRR3 Antibody [NBP2-13374] - Staining of human esophagus shows moderate cytoplasmic and nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SPRR3 Antibody [NBP2-13374] - Staining of human tonsil shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.
(1 Review)
Species: Hu
Applications: IHC, IHC-P
ATF3 Antibody
NBP1-85816
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human fallopian tube shows moderate to strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ATF3 Antibody [NBP1-85816] - Staining of human skeletal muscle shows no nuclear positivity in myelopoietic cells as expected.
(3 Reviews)
(16 Publications)
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
MMP-14/MT1-MMP
Antibody (3-F7)
NBP2-67415
Western Blot: MMP-14/MT1-MMP Antibody (3-F7) [NBP2-67415] - Analysis of MMP14 on human kidney tissue lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Flow Cytometry: MMP-14/MT1-MMP Antibody (3-F7) [NBP2-67415] - Analysis of A549 cells with MMP14 antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunohistochemistry-Paraffin: MMP-14/MT1-MMP Antibody (3-F7) [NBP2-67415] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-MMP14 antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MMP-12 Antibody
NBP1-31225
Immunohistochemistry-Paraffin: MMP-12 Antibody [NBP1-31225] - Human lung adenocarcinoma. MMP12 antibody [N3C1], Internal diluted at 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: MMP-12 Antibody [NBP1-31225] - Whole cell extract (30 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with MMP12 antibody [N3C1], Internal diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: MMP-12 Antibody [NBP1-31225] - Analysis of methanol-fixed H1299, using antibody at 1:500 dilution.
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Testican 3/SPOCK3
Antibody (1A10)
H00050859-M01
Testican 3/SPOCK3 Antibody (1A10)
Species: Hu
Applications: ELISA, S-ELISA

Publications for Testican 3/SPOCK3 Antibody (H00050859-M01) (0)

There are no publications for Testican 3/SPOCK3 Antibody (H00050859-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Testican 3/SPOCK3 Antibody (H00050859-M01) (0)

There are no reviews for Testican 3/SPOCK3 Antibody (H00050859-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Testican 3/SPOCK3 Antibody (H00050859-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Testican 3/SPOCK3 Products

Bioinformatics Tool for Testican 3/SPOCK3 Antibody (H00050859-M01)

Discover related pathways, diseases and genes to Testican 3/SPOCK3 Antibody (H00050859-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Testican 3/SPOCK3 Antibody (H00050859-M01)

Discover more about diseases related to Testican 3/SPOCK3 Antibody (H00050859-M01).
 

Pathways for Testican 3/SPOCK3 Antibody (H00050859-M01)

View related products by pathway.

Blogs on Testican 3/SPOCK3

There are no specific blogs for Testican 3/SPOCK3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Testican 3/SPOCK3 Antibody (1A10) and receive a gift card or discount.


Bioinformatics

Gene Symbol SPOCK3
Entrez
Uniprot