Recombinant Human Tesmin Protein

Images

 
SDS-Page: Recombinant Human Tesmin Protein [H00009633-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

Recombinant Human Tesmin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-306 of Human MTL5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASHPGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPPKITLAG

Protein/Peptide Type
Recombinant Protein
Gene
MTL5

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Tesmin Protein

  • CXC domain containing 2
  • CXCDC2
  • metallothionein-like 5, testis-specific (tesmin)
  • Metallothionein-like 5, testis-specific
  • MTLT
  • tesmin
  • Testis-specific metallothionein-like protein

Background

MTL5 - metallothionein-like 5, testis-specific (tesmin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-92065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
H00058524-R01
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00007150-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NBP2-03456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14194
Species: Hu
Applications: IHC, IHC-P
H00009633-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE

Publications for Tesmin Recombinant Protein (H00009633-P01) (0)

There are no publications for Tesmin Recombinant Protein (H00009633-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tesmin Recombinant Protein (H00009633-P01) (0)

There are no reviews for Tesmin Recombinant Protein (H00009633-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tesmin Recombinant Protein (H00009633-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tesmin Products

Bioinformatics Tool for Tesmin Recombinant Protein (H00009633-P01)

Discover related pathways, diseases and genes to Tesmin Recombinant Protein (H00009633-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Tesmin Recombinant Protein (H00009633-P01)

Find related products by research area.

Blogs on Tesmin

There are no specific blogs for Tesmin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Tesmin Antibody
NBP1-59090
SCP1 Antibody
NB300-229

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Tesmin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTL5