TERT Recombinant Protein Antigen

Images

 
There are currently no images for TERT Recombinant Protein Antigen (NBP2-56116PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TERT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TERT.

Source: E. coli

Amino Acid Sequence: GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TERT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56116.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TERT Recombinant Protein Antigen

  • EST2Telomerase-associated protein 2
  • hEST2
  • hTERT
  • TCS1EC 2.7.7.49
  • Telomerase catalytic subunit
  • telomerase reverse transcriptase
  • TERT
  • TP2HEST2
  • TRTEC 2.7.7

Background

Telomeres are nucleoprotein structures at the ends of eukaryotic chromosomes. Telomeres regulate several crucial cellular functions and participate in the control of complex phenotypes, such as aging and cancer. Cell immortalization is strongly associated with the stabilization of telomere length. Therefore, it is suggested that cancer cells achieve immortalization in part through illegitimate activation of telomerase expression. Telomerase reverse transcriptase (TERT) is the rate-limiting catalytic subunit of telomerase. Telomerase is a ribonucleoprotein composed of an internal telomerase RNA template (TERC) and the enzyme TERT. Telomerase is an enzyme uniquely associated with immortal cell lines and is useful for identifying undifferentiated PSCs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-77285
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
DCDL40
Species: Hu
Applications: ELISA
H00000054-D01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP1-87315
Species: Hu
Applications: IHC,  IHC-P
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-42325
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB200-585
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC,  IHC-P, WB

Publications for TERT Recombinant Protein Antigen (NBP2-56116PEP) (0)

There are no publications for TERT Recombinant Protein Antigen (NBP2-56116PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TERT Recombinant Protein Antigen (NBP2-56116PEP) (0)

There are no reviews for TERT Recombinant Protein Antigen (NBP2-56116PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TERT Recombinant Protein Antigen (NBP2-56116PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TERT Products

Research Areas for TERT Recombinant Protein Antigen (NBP2-56116PEP)

Find related products by research area.

Blogs on TERT.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Reversing Cancer with Telomerase Reverse Transcriptase (TERT)
Telomerase reverse transcriptase (TERT) is a ribonucleoprotein enzyme essential for eukaryotic chromosomal termini replication. It is a useful marker as it is active only in progenitor and most cancer cells, but inactive or (active at very low activit...  Read full blog post.

Featured Product Citation using Novus' hTERT Antibody
In December 2009, researchers at the University of Southern California cited using Novus’ mouse monoclonal Telomerase Reverse Transcriptase Antibody (cat# NB100-317) [PMID: 19923445]. Specifically, Novus’ hTERT antibody was used for immunofluorescent ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TERT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TERT