Tectorin alpha Antibody


Immunohistochemistry: Tectorin alpha Antibody [NBP1-85245] - Staining of human testis shows immunoreactivity in developing sperm cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

Tectorin alpha Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:VLHTFDGASYAFPSEFSYTLLKTCPERPEYLEIDINKKKPDAGPAWLRGLRILVADQEVKIGGIGASEVKLNGQE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tectorin alpha Protein (NBP1-85245PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Tectorin alpha Antibody

  • alpha-tectorin
  • DFNA12
  • DFNA8
  • DFNB21
  • tectorin alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Tectorin alpha Antibody (NBP1-85245) (0)

There are no publications for Tectorin alpha Antibody (NBP1-85245).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tectorin alpha Antibody (NBP1-85245) (0)

There are no reviews for Tectorin alpha Antibody (NBP1-85245). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tectorin alpha Antibody (NBP1-85245) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Tectorin alpha Products

Bioinformatics Tool for Tectorin alpha Antibody (NBP1-85245)

Discover related pathways, diseases and genes to Tectorin alpha Antibody (NBP1-85245). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tectorin alpha Antibody (NBP1-85245)

Discover more about diseases related to Tectorin alpha Antibody (NBP1-85245).

Pathways for Tectorin alpha Antibody (NBP1-85245)

View related products by pathway.

PTMs for Tectorin alpha Antibody (NBP1-85245)

Learn more about PTMs related to Tectorin alpha Antibody (NBP1-85245).

Blogs on Tectorin alpha

There are no specific blogs for Tectorin alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Tectorin alpha Antibody and receive a gift card or discount.


Gene Symbol TECTA