TCTN1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TCTN1 Antibody [NBP1-83624] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: TCTN1 Antibody [NBP1-83624] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TCTN1 Antibody [NBP1-83624] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Immunohistochemistry-Paraffin: TCTN1 Antibody [NBP1-83624] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TCTN1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TCTN1 Antibody - BSA Free (NBP1-83624) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCTN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TCTN1 Protein (NBP1-83624PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TCTN1 Antibody - BSA Free

• JBTS13
• TCTN1
• TECT1
• TECT1FLJ21127
• tectonic 1
• tectonic family member 1
• Tectonic-1

Background

TCTN1 encodes a member of the tectonic family of secreted and transmembrane proteins. The orthologous gene in mouse is required for formation of most ventral cell types. It functions downstream of smoothened and rab23 to modulate hedgehog signal transduction. Multiple transcript variants encoding different isoforms have been found for this gene. Transcript Variant: This variant (3) uses an alternate exon combination in the central coding region and an alternate in-frame splice site in the 3' coding region, compared to variant 1, resulting in a shorter protein (isoform 3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCTN1