TCTN1 Antibody

Images

 
Immunohistochemistry-Paraffin: TCTN1 Antibody [NBP1-83624] - Staining of human kidney shows distinct cytoplasmic and membranous positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCTN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCTN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TCTN1 Protein (NBP1-83624PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCTN1 Antibody

  • TECT1FLJ21127
  • tectonic 1
  • tectonic family member 1
  • tectonic-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-88392
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94023
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77183
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBL1-17065
Species: Hu
NBP2-15463
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-92683
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-88969
Species: Hu
Applications: IHC, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02984
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33656
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-93673
Species: Hu
Applications: IHC, IHC-P
NBP1-83624
Species: Hu
Applications: IHC, IHC-P

Publications for TCTN1 Antibody (NBP1-83624) (0)

There are no publications for TCTN1 Antibody (NBP1-83624).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCTN1 Antibody (NBP1-83624) (0)

There are no reviews for TCTN1 Antibody (NBP1-83624). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TCTN1 Antibody (NBP1-83624) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCTN1 Products

Bioinformatics Tool for TCTN1 Antibody (NBP1-83624)

Discover related pathways, diseases and genes to TCTN1 Antibody (NBP1-83624). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCTN1 Antibody (NBP1-83624)

Discover more about diseases related to TCTN1 Antibody (NBP1-83624).

Blogs on TCTN1

There are no specific blogs for TCTN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCTN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCTN1