TCR V delta Antibody (2H6)

Images

 
Western Blot: TCR V delta Antibody (2H6) [H00006964-M01] - TCR V delta antibody (M01), clone 2H6 Analysis of TCR V delta expression in Hela S3 NE.
Sandwich ELISA: TCR V delta Antibody (2H6) [H00006964-M01] - Detection limit for recombinant GST tagged TCR V delta is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TCR V delta Antibody (2H6) Summary

Immunogen
TCR V delta(CAA29800, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLR
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00006964-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCR V delta Antibody (2H6)

  • C)
  • D
  • FLJ52034
  • FLJ52576
  • FLJ53668
  • FLJ54555
  • FLJ55265
  • FLJ56790
  • J
  • T cell receptor delta locus
  • T-cell antigen receptor, delta polypeptide
  • T-cell receptor, delta (V
  • TCRD
  • TCRDV1
  • TRD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-74080
Species: Hu
Applications: WB
H00006976-B01P
Species: Hu
Applications: ICC/IF, WB
NB100-65265
Species: Hu, Mu(-), Rt(-)
Applications: IHC, IHC-Fr, IP
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB7650
Species: Mu
Applications: IHC, WB
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
NBP2-43666
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-74190
Species: Mu
Applications: ChIP, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB

Publications for TCR V delta Antibody (H00006964-M01)(1)

Reviews for TCR V delta Antibody (H00006964-M01) (0)

There are no reviews for TCR V delta Antibody (H00006964-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCR V delta Antibody (H00006964-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCR V delta Products

Bioinformatics Tool for TCR V delta Antibody (H00006964-M01)

Discover related pathways, diseases and genes to TCR V delta Antibody (H00006964-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCR V delta Antibody (H00006964-M01)

Discover more about diseases related to TCR V delta Antibody (H00006964-M01).
 

Pathways for TCR V delta Antibody (H00006964-M01)

View related products by pathway.

Blogs on TCR V delta

There are no specific blogs for TCR V delta, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCR V delta Antibody (2H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRD
Entrez
OMIM
Uniprot