TAX1BP3 Antibody

Images

 
Western Blot: TAX1BP3 Antibody [NBP2-55345] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: TAX1BP3 Antibody [NBP2-55345] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & actin filaments.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAX1BP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Specificity
Specificity of human TAX1BP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAX1BP3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAX1BP3 Recombinant Protein Antigen (NBP2-55345PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TAX1BP3 Antibody

  • 1G5
  • caM kinase-like vesicle-associated protein
  • CaM kinase-like vesicle-associated
  • MGC8407
  • VACAMKL
  • vesicle-associated calmodulin-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8864
Species: Hu
Applications: IHC
NBP2-02269
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-44318
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-76626
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85734
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-45966
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-12902
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-90029
Species: Hu
Applications: WB, IHC, IHC-P
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TAX1BP3 Antibody (NBP2-55345) (0)

There are no publications for TAX1BP3 Antibody (NBP2-55345).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAX1BP3 Antibody (NBP2-55345) (0)

There are no reviews for TAX1BP3 Antibody (NBP2-55345). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAX1BP3 Antibody (NBP2-55345) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAX1BP3 Products

Bioinformatics Tool for TAX1BP3 Antibody (NBP2-55345)

Discover related pathways, diseases and genes to TAX1BP3 Antibody (NBP2-55345). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAX1BP3 Antibody (NBP2-55345)

Discover more about diseases related to TAX1BP3 Antibody (NBP2-55345).
 

Pathways for TAX1BP3 Antibody (NBP2-55345)

View related products by pathway.

PTMs for TAX1BP3 Antibody (NBP2-55345)

Learn more about PTMs related to TAX1BP3 Antibody (NBP2-55345).
 

Research Areas for TAX1BP3 Antibody (NBP2-55345)

Find related products by research area.

Blogs on TAX1BP3

There are no specific blogs for TAX1BP3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAX1BP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAX1BP3