TAX1BP3 Antibody

Western Blot: TAX1BP3 Antibody [NBP2-55345] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: TAX1BP3 Antibody [NBP2-55345] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & actin filaments.

Western Blot: TAX1BP3 Antibody [NBP2-55345] - Analysis in human cell line SiHa.

Product Discontinued

TAX1BP3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAX1BP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 1:100 - 1:250
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TAX1BP3 Antibody

• 1G5
• caM kinase-like vesicle-associated protein
• CaM kinase-like vesicle-associated
• MGC8407
• VACAMKL
• vesicle-associated calmodulin-binding protein

Background

TAX1BP3 may play a role in the Rho signaling pathway. May act as an inhibitor of the Wnt signaling pathway

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAX1BP3