TAS1R1 Recombinant Protein Antigen

Images

 
There are currently no images for TAS1R1 Protein (NBP1-83338PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TAS1R1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAS1R1.

Source: E. coli

Amino Acid Sequence: IPNDKYQVETMVLLLQKFGWTWISLVGSSDDYGQLGVQALENQATGQGICIAFKDIMPFSAQVGDERMQCLMRHLAQAGATVVVVFSSRQLARVFFESVVLTNLTGKVW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAS1R1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83338.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TAS1R1 Recombinant Protein Antigen

  • GPR70
  • G-protein coupled receptor 70
  • seven transmembrane helix receptor
  • T1R1TR1G protein-coupled receptor 70
  • taste receptor type 1 member 1
  • taste receptor, type 1, member 1

Background

FUNCTION: Putative taste receptor. TAS1R1/TAS1R3 responds to the umami taste stimulus (the taste of monosodium glutamate) and also to most of the 20 standard L-amino acids, but not to their D-enantiomers or other compounds. Sequence differences within and between species can significantly influence the selectivity and specificity of taste responses.; SUBUNIT: Forms heterodimers with TAS1R3.; SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein.; TISSUE SPECIFICITY: Expressed strongly only in fungiform papillae.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY417
Species: Mu
Applications: ELISA
NLS2007
Species: Hu
Applications: IHC,  IHC-P
NLS5060
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7428
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
664-LI
Species: Hu
Applications: BA
MAB356
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
H00091614-B01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-56277
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP1-86919
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
202-IL
Species: Hu
Applications: BA
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB200-585
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
485-MI
Species: Mu
Applications: BA
DR2A00
Species: Hu
Applications: ELISA
943-D3
Species: Hu
Applications: Bind

Publications for TAS1R1 Protein (NBP1-83338PEP) (0)

There are no publications for TAS1R1 Protein (NBP1-83338PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAS1R1 Protein (NBP1-83338PEP) (0)

There are no reviews for TAS1R1 Protein (NBP1-83338PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TAS1R1 Protein (NBP1-83338PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAS1R1 Products

Research Areas for TAS1R1 Protein (NBP1-83338PEP)

Find related products by research area.

Blogs on TAS1R1.

Taste Infographic: Explaining Taste from the Tongue to the Brain
The sense of taste involves the reaction of chemicals with nerve cells which send messages to the brain to create the perception of flavor. Learn more about taste and in the infographic below.Novus Biologicals offers research reagents mentioned in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TAS1R1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TAS1R1