Recombinant Human TAO2 Protein

Images

 
SDS-Page: Recombinant Human TAO2 Protein [H00009344-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human TAO2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 831-930 of Human TAO2

Source: Wheat Germ

Amino Acid Sequence: ELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQ

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TAOK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAO2 Protein

  • EC 2.7.11
  • KFC-C
  • KIAA0881PSK-1
  • Kinase from chicken homolog C
  • MAP3K17
  • MAP3K17PSK1-BETA
  • Prostate-derived STE20-like kinase 1
  • PSK1
  • PSK1EC 2.7.11.1
  • PSKhKFC-C
  • serine/threonine-protein kinase TAO2
  • TAO kinase 2
  • TAO1
  • TAO2
  • TAO2prostate derived STE20-like kinase PSK
  • TAOK2
  • Thousand and one amino acid protein 2
  • thousand and one amino acid protein kinase

Background

TAOK2 - TAO kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB120-7325
Species: Bv
Applications: WB, ELISA, IHC, IHC-P
NBP2-31106
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, ICC
NBP1-06579
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
NLS6871
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
7270-IL/CF
Species: Hu
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
H00005670-Q01
Species: Hu
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
6507-IL/CF
Species: Hu
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009344-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for TAO2 Partial Recombinant Protein (H00009344-Q01) (0)

There are no publications for TAO2 Partial Recombinant Protein (H00009344-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAO2 Partial Recombinant Protein (H00009344-Q01) (0)

There are no reviews for TAO2 Partial Recombinant Protein (H00009344-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAO2 Partial Recombinant Protein (H00009344-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for TAO2 Partial Recombinant Protein (H00009344-Q01)

Discover related pathways, diseases and genes to TAO2 Partial Recombinant Protein (H00009344-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAO2 Partial Recombinant Protein (H00009344-Q01)

Discover more about diseases related to TAO2 Partial Recombinant Protein (H00009344-Q01).
 

Pathways for TAO2 Partial Recombinant Protein (H00009344-Q01)

View related products by pathway.

Research Areas for TAO2 Partial Recombinant Protein (H00009344-Q01)

Find related products by research area.

Blogs on TAO2

There are no specific blogs for TAO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4
6507-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TAO2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TAOK2