We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TAF15 Recombinant Protein Antigen

Images

 
There are currently no images for TAF15 Recombinant Protein Antigen (NBP2-57720PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TAF15 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAF15.

Source: E. coli

Amino Acid Sequence: SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TAF15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57720.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TAF15 Recombinant Protein Antigen

  • 68kDa
  • hTAFII68
  • Npl3
  • RBP56TAFII68
  • RNA-binding protein 56
  • TAF(II)68
  • TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF2NRBP56/CSMF fusion
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD(RNA-binding protein 56)
  • TATA box-binding protein-associated factor 2N (RNA-binding protein 56)
  • TATA-binding protein-associated factor 2N
  • TBP-associated factor 15,68 kDa TATA-binding protein-associated factor

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NB200-182
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, Simple Western, WB
PP-H7833-00
Species: Hu
Applications: IP, WB
NB100-2425
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-94454
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB5745
Species: Hu
Applications: IHC, WB
NBP1-86125
Species: Hu
Applications: IHC,  IHC-P
NBP2-01291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-38806
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-70411
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB6519
Species: Hu, Mu
Applications: IHC, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00010921-M05
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NBP1-87784
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF2818
Species: Hu
Applications: ICC, WB
NBP1-76535
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-57100
Species: Hu
Applications: ICC/IF

Publications for TAF15 Recombinant Protein Antigen (NBP2-57720PEP) (0)

There are no publications for TAF15 Recombinant Protein Antigen (NBP2-57720PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF15 Recombinant Protein Antigen (NBP2-57720PEP) (0)

There are no reviews for TAF15 Recombinant Protein Antigen (NBP2-57720PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TAF15 Recombinant Protein Antigen (NBP2-57720PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAF15 Products

Array NBP2-57720PEP

Research Areas for TAF15 Recombinant Protein Antigen (NBP2-57720PEP)

Find related products by research area.

Blogs on TAF15

There are no specific blogs for TAF15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TAF15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF15