TAF15 Antibody

Images

 
Western Blot: TAF15 Antibody [H00008148-B01P] - Analysis of TAF15 expression in transfected 293T cell line by TAF15 polyclonal antibody. Lane 1: TAF15 transfected lysate(65.12 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: TAF15 Antibody [H00008148-B01P] - Analysis of purified antibody to TAF15 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TAF15 Antibody Summary

Immunogen
TAF15 (NP_631961.1, 1 a.a. - 592 a.a.) full-length human protein. MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY
Specificity
TAF15 - TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TAF15
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAF15 Antibody

  • 68kDa
  • hTAFII68
  • Npl3
  • RBP56TAFII68
  • RNA-binding protein 56
  • TAF(II)68
  • TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF2NRBP56/CSMF fusion
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD(RNA-binding protein 56)
  • TATA box-binding protein-associated factor 2N (RNA-binding protein 56)
  • TATA-binding protein-associated factor 2N
  • TBP-associated factor 15,68 kDa TATA-binding protein-associated factor

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a subunit of TFIID present in a subset of TFIID complexes. Translocations involving chromosome 17 and chromosome 9, where the gene for the nuclear receptor CSMF is located, result in a gene fusion product that is an RNA binding protein associated with a subset of extraskeletal myxoid chondrosarcomas. Two transcripts encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81639
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-86675
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP2-01291
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6519
Species: Hu, Mu
Applications: WB, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP1-87784
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-76535
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-57100
Species: Hu
Applications: ICC/IF

Publications for TAF15 Antibody (H00008148-B01P) (0)

There are no publications for TAF15 Antibody (H00008148-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF15 Antibody (H00008148-B01P) (0)

There are no reviews for TAF15 Antibody (H00008148-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAF15 Antibody (H00008148-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAF15 Products

Bioinformatics Tool for TAF15 Antibody (H00008148-B01P)

Discover related pathways, diseases and genes to TAF15 Antibody (H00008148-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF15 Antibody (H00008148-B01P)

Discover more about diseases related to TAF15 Antibody (H00008148-B01P).
 

Pathways for TAF15 Antibody (H00008148-B01P)

View related products by pathway.

PTMs for TAF15 Antibody (H00008148-B01P)

Learn more about PTMs related to TAF15 Antibody (H00008148-B01P).
 

Research Areas for TAF15 Antibody (H00008148-B01P)

Find related products by research area.

Blogs on TAF15

There are no specific blogs for TAF15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF15
Entrez
Uniprot