Recombinant Human TAF12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TAF12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-161 of Human TAF12 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Protein/Peptide Type
Recombinant Protein
Gene
TAF12

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAF12 Protein

  • 20kDa
  • TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF15
  • TAF2J
  • TAFII-20/TAFII-15
  • TAFII20TAFII20/TAFII15
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD
  • Transcription initiation factor TFIID 20/15 kDa subunits
  • transcription initiation factor TFIID subunit 12

Background

Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NBP1-86675
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB6519
Species: Hu, Mu
Applications: WB, IHC
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP2-24750
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NBP1-86971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82774
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF

Publications for TAF12 Recombinant Protein (H00006883-P01) (0)

There are no publications for TAF12 Recombinant Protein (H00006883-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF12 Recombinant Protein (H00006883-P01) (0)

There are no reviews for TAF12 Recombinant Protein (H00006883-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAF12 Recombinant Protein (H00006883-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAF12 Products

Bioinformatics Tool for TAF12 Recombinant Protein (H00006883-P01)

Discover related pathways, diseases and genes to TAF12 Recombinant Protein (H00006883-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF12 Recombinant Protein (H00006883-P01)

Discover more about diseases related to TAF12 Recombinant Protein (H00006883-P01).
 

Pathways for TAF12 Recombinant Protein (H00006883-P01)

View related products by pathway.

PTMs for TAF12 Recombinant Protein (H00006883-P01)

Learn more about PTMs related to TAF12 Recombinant Protein (H00006883-P01).

Blogs on TAF12

There are no specific blogs for TAF12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TAF12 Antibody
NBP1-80703
GDNF [Unconjugated]
212-GD-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TAF12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF12