TAF12 Antibody

Western Blot: TAF12 Antibody [H00006883-B01P] - Analysis of TAF12 expression in transfected 293T cell line by TAF12 polyclonal antibody. Lane1:TAF12 transfected lysate(17.82 KDa). Lane 2:Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: TAF12 Antibody [H00006883-B01P] - Analysis of purified antibody to TAF12 on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

TAF12 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: TAF12 (AAH11986, 1 a.a. - 161 a.a.) full-length human protein. MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
• Specificity: TAF12 - TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TAF12
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAF12 Antibody

• 20kDa
• TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor
• TAF15
• TAF2J
• TAFII-20/TAFII-15
• TAFII20TAFII20/TAFII15
• TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD
• Transcription initiation factor TFIID 20/15 kDa subunits
• transcription initiation factor TFIID subunit 12

Background

Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF12
• Entrez:
  • 6883(Human)
• Uniprot:
  • AAH11986(Human)