TADA3L Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TADA3L Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TADA3.
  
  

  Source: E. coli

  Amino Acid Sequence: LAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TADA3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90243.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TADA3L Recombinant Protein Antigen

• ADA3 homolog
• ADA3
• alteration/deficiency in activation 3
• epididymis secretory sperm binding protein
• FLJ20221
• FLJ21329
• hADA3
• NGG1
• STAF54
• TADA3L
• transcriptional adapter 3
• Transcriptional adapter 3-like
• transcriptional adaptor 3

Background

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated genetranscription by interacting functionally with the general transcription machinery bound at the basal promoter.Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, therebyrelieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activatoradaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumorsuppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least fouralternatively spliced variants have been found for this gene, but the full-length nature of some variants has not beendetermined. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TADA3