TADA3L Recombinant Protein Antigen

Images

 
There are currently no images for TADA3L Recombinant Protein Antigen (NBP1-90243PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TADA3L Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TADA3.

Source: E. coli

Amino Acid Sequence: LAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TADA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90243.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TADA3L Recombinant Protein Antigen

  • ADA3 homolog
  • ADA3
  • alteration/deficiency in activation 3
  • epididymis secretory sperm binding protein
  • FLJ20221
  • FLJ21329
  • hADA3
  • NGG1
  • STAF54
  • TADA3L
  • transcriptional adapter 3
  • Transcriptional adapter 3-like
  • transcriptional adaptor 3

Background

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated genetranscription by interacting functionally with the general transcription machinery bound at the basal promoter.Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, therebyrelieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activatoradaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumorsuppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least fouralternatively spliced variants have been found for this gene, but the full-length nature of some variants has not beendetermined. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92547
Species: Hu, Mu, Rt
Applications: WB
NBP3-37988
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
2695-SE
Species: Hu
Applications: EnzAct
H00008850-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-45301
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-45466
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PAGE, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-45516
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC,  IHC-P, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-07996
Species: Hu
Applications: WB
NBP1-90813
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for TADA3L Recombinant Protein Antigen (NBP1-90243PEP) (0)

There are no publications for TADA3L Recombinant Protein Antigen (NBP1-90243PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TADA3L Recombinant Protein Antigen (NBP1-90243PEP) (0)

There are no reviews for TADA3L Recombinant Protein Antigen (NBP1-90243PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TADA3L Recombinant Protein Antigen (NBP1-90243PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TADA3L Products

Research Areas for TADA3L Recombinant Protein Antigen (NBP1-90243PEP)

Find related products by research area.

Blogs on TADA3L

There are no specific blogs for TADA3L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TADA3L Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TADA3