Recombinant Human TADA1L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TADA1L Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 335 of Human TADA1L full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLAILTRCQILVSTPDGAGSLPWPGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLSGAQQFVAKDPQDDDDLKLCSHTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVENHLKDILTSVVSRRKAYRLRDGHFKYAFGSNVTPQPYLKNSVVAYNNLIESPPAFTAPCAGQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC

Protein/Peptide Type
Recombinant Protein
Gene
TADA1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TADA1L Protein

  • ADA1
  • hADA1
  • HFI1
  • SPT3-associated factor 42 (STAF42)
  • SPT3-associated factor 42
  • STAF42transcriptional adaptor 1 (HFI1 homolog, yeast)-like
  • TADA1LRP1-9E21.4
  • transcriptional adapter 1
  • Transcriptional adapter 1-like protein
  • transcriptional adaptor 1 (HFI1 homolog, yeast)
  • transcriptional adaptor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57507
Species: Hu
Applications: ICC/IF
NBP1-89238
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-90243
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-45466
Species: Hu
Applications: WB, IHC
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
AF7365
Species: Hu, Mu, Rt
Applications: WB
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-86165
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5075
Species: Hu, Mu, Rt
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00117143-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TADA1L Recombinant Protein (H00117143-P01) (0)

There are no publications for TADA1L Recombinant Protein (H00117143-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TADA1L Recombinant Protein (H00117143-P01) (0)

There are no reviews for TADA1L Recombinant Protein (H00117143-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TADA1L Recombinant Protein (H00117143-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TADA1L Products

TADA1L H00117143-P01

Bioinformatics Tool for TADA1L Recombinant Protein (H00117143-P01)

Discover related pathways, diseases and genes to TADA1L Recombinant Protein (H00117143-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TADA1L

There are no specific blogs for TADA1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TADA1L Antibody
NBP1-56629

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TADA1L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TADA1